Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G123277-GRMZM2G304274
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100272531
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.9738402230128
Log2 mRNA fold difference:-2.3820854523209
Log2 TE fold difference:0.3973322475723
Sequences
Protein sequence

MMSRSYTNLLDLAEGNFAALGPAGGSGRQRHGSFGLRRMSRVMTVPGTLSELDGEDESEP
AATSSVASDVPSSVAVDRLIVVSNQLPIVARRRPDGRGWSFSWDGDSLLLQLRDGIPDEM
EVLFVGSLRADVPAAEQDEVSQTLLDRFRCAPVFLPDHLNDRFYHGFCKRQLWPLFHYML
PFSSPASASAAATSSSVATSSPGNGRFDRSAWEAYVLANKFFFEKVVEVINPEDDYVWVH
DYHLLALPTFLRRRFNRLRIGFFLHSPFPSSEIYRTLPVRDEILKALLNCDLIGFHTFDY
ARHFLSCCSRMLGIEYQSKRGHIGLDYFGRTVGIKIMPVGVHMGQLESGLRLPDREWRLS
ELQQQFQGKTVLLGVDDMDIFKGINLKLLAFENMLRTHPKWQGRAVLVQIANPARGRGKD
LEAIQAEIEESCQRINGDFGQSGYSPVVFIDRDVSSVEKIAYYTIAECVVVTAVRDGMNL
TPYEYIVCRQGAPGSESVSEVGGPKKSMLVVSEFIGCSPSLSGAIRVNPWNIEATAEAMN
EAISMPEQEKQLRHEKHYRYVSSHDVAYWSKSFILDLERACRDHFKRTCWGIGLGFGFRV
VALDAHFRKLNMDSIVNAYEISGSRAILLDYDGTLVPQTSINKEPSPEVLNIINTLCSDS
RNIVFLVSGRDKDMLGKWFSSCPKLGIAAEHGYFLRWSSEEEWQTCTQAMDFGWMQMAKP
VMNLYTEATDGSYIETKESALVWHHQDADPGFGSSQAKELLDHLESVLANEPVSVKSGQF
IVEVKPQGVSKGIVAERILASVKERGKQADFVLCIGDDRSDEDMFENIADIIKRNMVAPR
TSLFACTVGQKPSKAKFYLDDTFEVVAMLSALADATGAELESDSADELAASISSLDIGDE
QSETSDTPIGGS*

MMSRSYTNLLDLAEGNFAALGPVGGSGRQRHGSFGLRRMSRVMTVPGTLTELDGEDESEP
AATSSVASDVPSSVAADRLIVVSNQLPIVARRRPDGRGWSFSWDDDSLLLQLRDGIPDEM
EVLFVGSLRADVPAAEQDAVSQALLDRFRCAPVFLPDHLNDRFYHGFCKRQLWPLFHYML
PFSSPASASAAATSSSVATSSPGNGCFDRSAWEAYVLANKFFFEKVVEVINPEDDYVWVH
DYHLLALPTFLRRRFNRLRIGFFLHSPFPSSEIYRTLPVRDEILKALLNCDLIGFHTFDY
ARHFLSCCSRMLGIEYQSKRGYIGLDYFGRTVGIKIMPVGVHMGQLESGLRLPDREWRLS
ELQQQFQGKTVLLGVDDMDIFKGINLKLLAFENMLRTHPKWQGRAVLVQIANPARGRGKD
LEAIQAEIEQSCQRINVDFGQSGYSPVVFINRDVSSVEKVAYYTIAECVVVTAVRDGMNL
TPYEYIVCRQGAPGSESVSEVSGPKKSMLVVSEFIGCSPSLSGAIRVNPWNIEATAEAMN
EAISMPEQEKQLRHEKHYRYVSSHDVAYWSKSFILDLERACRDHFKRTCWGIGLGFGFRV
VALDPHFRKLNMDSIVNAYEISESRAILLDYDGTLVPQTSINKEPSPEVLNIINTLCSDS
RNIVFLVSGRDKDTLGKWFSSCPKLGIAAEHGYILRWSSKEEWQTCTQAMDFGWMQMAKP
VMNLYTEATDGSYIERKESALVWHHQDADPGFGSSQAKELLDHLESVLANEPVSVKSGQF
IVEVKPQGVSKGIVAERILASVKERGKQADFVLCIGDDRSDEDMFENIADIIKRNMVAPR
TSLFACTVGQKPSKAKFYLDDTFEVVAMLSALADATGAELKSDSADELAASISSLDIGDE
QSESSDTPIGGS*

Other information
Ka divergence:0.146067KaKs divergence:-0.0541113
GC content 1 (%):53GC content 2 (%):52GC content divergence:-0.01
Length 1 (bp):2739Length 2 (bp):2739Length divergence:0
MFE 1 (kcal):-1043.56MFE 2 (kcal):-1004.75MFE divergence-0.019