Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G123371-GRMZM2G042502
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193340
Function (paralog2):LOC100280449

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT
YGQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK
LIGFLGGSDGLLAQRTLEITDKVIASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK
LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV
NAQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD
ITKQICDAVQARAEKDKNHGVILIPEGLVESIPELYALLQEIHGLHGKGVSVENISSQLS
PWASALFEFLPPFIRKQLLLHPESDDSAQLSQIETEKLLAQLVETEMNRRLKEGTYKGKK
FNAICHFFGYQARGALPSKFDCDYAYVLGHVCYHIIAAGLNSYMATVTNLKNPVNKWRCG
ATPISSMMTVKRWSRGPSATQIGKPAVHMASVDLKGKAYDVLRQNSSSFLLEDVYRNPGP
LQFEGPGADSKPISLCVEDQDYMGRIKKLQEYLEKVKRIVKPGCSQDVLKAALSAMSSVT
ETLNIMTSSSTGQTPLSH*

MDSDYGVPRELSEVQKKRALYQPEVPPCLQGTTVRVEYGDAAIAADQAGAHVISHAFPHT
YGQPLAHFLRKTAVVLDAKVISEHPVVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK
LIGFLGGSDGLLAQRTLEITNEVLASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK
LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV
NAQLISNVCTDALSAEKYYYFIRLMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD
ITKQICDAVQARAEKDKNHGVVLIPEGLVESIPELYALLQEIHGLHGKGVSVENISSQLS
PWASALFEFLPPFIRKQLLLHPESDDSAQLSQIETEKLLAQLVETEMNRRLKEGTYKGKK
FNAICHFFGYQARGALPSKFDCDYAYVLGHVCYHIIAAGLNGYMATVTNVKSPVNKWRCG
AAPISSMMTVQRWSRGPSATQIGKPAVHMASVDLKGKAYDVLRQNSSRFLLEDVYRNPGP
LQFEGPGADSKPISLCVEDQDYMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVT
ETLNIMTSSSTGQTAL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):1857Length 2 (bp):1851Length divergence:-0.002
MFE 1 (kcal):-653.79MFE 2 (kcal):-656.8MFE divergence0.002