Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G123519-GRMZM2G122003
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEDDCDDDFDGYDEDDYDFDEADFNQHLADKFDDLDLPPGVEATVPWLQKTTPKEDVKEP
PKSNTADENANKYTQFKQFDTVQNFSDHYYAKNSHGEPNRAWSKRVQHDWKLLEKDLPAY
IFVRVAEDRMDLLRAAIIGPKGTPYHDGLFFFDIHIPSAYPCAPPLVYYHSGGLRINPNL
YNNGKVCLSLLGTWDGRGCEKWNPAQSTMLQVLVSIQALILNDKPYYNEPGYESYANTPN
GERLALDYNDNTFLHSCKTMLYSLRRPPEHFADLVAGHFRVHGHTILAACKHYMAGNDIG
SVVPEEEEEEEEEESSEHKSGDAGASGSAPELGVIKAIPTKRRSSFNPSLKVLYEDLLME
FNVKGADTRKFIDEKLKKNKPAAA*

MDTEYRALQQGSPSPWRTADGVSSWGPAQHQKRQRCQGSSSDQAGSSSSSSLQISEPEPQ
QNQEEDYYVEDDCDAYDEDDYDFDEAEFNLHLADKFDDLDLPPGVEANVPWLQKIPPKEV
VKQPPISITADENANKYDKFKQFDTVQTFSDHHYAKNSHEEPTRAWSKRVQHDWKLLEND
LPAYIYVRVAEDRMDLLRAAIIGPKGTPYHDGLFFFDVHIPSAYPSGPPLVYYHSGGLRI
NPNLYENGRVCLSLLGTWDGRGCEKWNPAQSTMLQVLVSIQALILNEKPYYNEPGYESFA
TTPNGQLLALKYNDDTFLYSCRTMLYSLRRPPEHFADLVAGHFRVHGHTILAACKHYMAG
NDIGSVVPEEEEESASRSAPKAKPGVIRTIPLNRRYAGSFDTSLKVLYEDLLMEFNVKGA
DTRKFMIEKLKKDQPAGT*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1155Length 2 (bp):1317Length divergence:0.066
MFE 1 (kcal):-371.23MFE 2 (kcal):-416.65MFE divergence0.058