Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G123796-GRMZM2G042195
Species:maize
Duplication type:WGD
Function (paralog1):RNA-binding region-containing protein 1
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAMQQHAASASSSSLGLHLLASPSSIREATHTKVFVGGLAWETSSDRLRRFYERFGDILE
AVVITDRHSGRSKGYGFVTFREAESASKACEDPTPVIDGRRANCNLASLGRAQHPVPPGR
PRSAGSYLGVPVPKAFYLGGYSHHRPFPLGYYQGFPVPQYSYPSYGTEYIYPQGTLNSYS
GQQYLPIYGVSAAANTSNQAFSQLSPSVSGGGNGYLSVHSYNVPGNQYVQLTGSNFSGAS
PTARPSIQTSFLVATPVPAHPHLIIPAPSPQFTQASGSDQSAS*

MATQQQHAGPASGSASASSSSSGLHLPASPSAFGDTTHTKVFVGGLAWETNSGRLRRFYE
RFGDILEAVVITDRHSGRSKGYGFVGASRFHFFFAVFFLASRVCVCARWMSCEDVLVFLL
SLLPQVTFREAESARKACEDPTPVIDGRRANCNLASLGRAQHPVHPGRPSSAGSYFGVPV
PRAFYLGGYGHHRPFPLGYYQGFPVPQYSYPSYGTEYISPQGTLNPYPAQQYLPIYGVSA
AANTANQTFNQLNPYISGGGNGYMSVHSYNMPGNQYVQLTGSNFSSASPTAQPSCQTPFL
VATPVPAHPHLIIPAPSPQFTQASGSDQRAS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):54GC content divergence:-0.018
Length 1 (bp):852Length 2 (bp):996Length divergence:0.078
MFE 1 (kcal):-301.5MFE 2 (kcal):-342.44MFE divergence0.064