Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G123843-GRMZM2G313460
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383630
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.96982731344555
Log2 mRNA fold difference:0.79382061499977
Log2 TE fold difference:0.20016954229929
Sequences
Protein sequence

MADLVMAPPPAMDLFGEPIEAHPPWFKPDAFLRAGFDADAYVAELRSYVPLDSLAAELRA
HLAALRAELVGLINRDYADFVGLSAHLKGVDAAAARMRAPLADLRDKVAAFRAGASAALA
ALREGLQQRAAATAARELLELLLDTSHVVSKVEKLIKELPTAPSDSSNAEIPINDTGTPN
GKAGTGVRETQSILLERIASEMNRLKFYISHAENLPFIENMEKRIQGATKLLDGSLERCF
VDGLEHRDAKVIYNCLRAYAAIDNTSSAEELFRTTVVSPLIQKIVPQNYARAVAGASSDE
LEEDYQQIKACVEKDCKFILEISSSENSGLHVFDFLGNSILKEVLSAIQKGKPGAFSPGK
PKEFLRNYKVSLGFLDFLEGYCFSKSAVTKLRYEPAYTDFMRQWNVGVYFSLRFQEIAGG
LDSTLTNTFSPTGLNEAQQKPLLLKQSIKLLESLDSCWSDEVLVFSHCDKFLRLSLQLIS
RYTTWLSCGLSARKASDRSPNSPADAEWALSIPIEDFIYIMHDVHAVIGELSESGSFIGH
VNQSLGSCPIEVFNLVKGSILQAAEPLKELLPAIMDVMIGIIVKKSNEDLKHLKGITATY
RMTSKLPVRHSPYVSGILHPLKVFLEGDRMHYLSEDDKTKLCRGSANKITATYYDLVSEV
VTVARKTESSLQRLRQGAQRRVGASTDASDSIISDTDKICMQLFLDIQEYARNLRAIGID
AREIDSYRALWQCVAPKDRHENIQF*

MADLATDLFGEPIEAHPPWFKPDAFLRASFDPDAYVAELRSYVPLESLAAELRAHLDALR
AELVGLINRDYADFVGLSARLKGVDAAAARMRAPLADLRDKVAAFRAGASAALAALRAGL
EQRAAAAAARELLELLLDAFHVVSKVEKLIKELPTAPSDLSNAEVPNSDTGTPNGVAGTG
VSETQSILLERIASEMNRLKFYISHAQNLPFIENMEKRVQGATKLLDGSLERCFVDGLEH
RDAKVIYNCLRAYAAIDNTSSAEELFRTAVVSPLIQKIIPQNYARAVAGASSDELEEDYQ
QIKECVQKDCKFILEISSSENSGLHVFDFLGNSILKEVLSTIQKGKPGAFSPGKPKEFLR
NYKASLGFLDFLEGYCISKSAVTKFRSELAYTDFMRQWNVGVYFSLRFQEIAGGLDSTLT
NTFSPTGLNEAQGKPLLLKQSIKLLESLDSCWSDEVLVFSHCDKFLRLSLQLISRYTTWL
SSGLTARKASDGSPNSPADAEWALSIPIEDFIYIMHDVHAVIGELSESGSFIGHVNQLLG
SCPIEVFNLVKQSILQAVEPLKERLPAIINVMIGIIVKKSNEDLKHLKGITATYRMTSKL
PVRHSPYVSGILHPLKVFLEGDRIRYLSEDDKTKLCRGSTDKITAIYYDLVSEVVTVARK
TESSLQRLRQGAQRRVGASTDASDNIISDTDKICMQLFLDIQEYARNLRAIGIDAREIDS
YRALWQCVAPKDRQENIQF*

Other information
Ka divergence:-0.261511KaKs divergence:-0.25853
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2238Length 2 (bp):2220Length divergence:-0.004
MFE 1 (kcal):-758.42MFE 2 (kcal):-730.56MFE divergence-0.019