Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G123901-GRMZM2G159950
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273803
Function (paralog2):hypothetical protein LOC100216689

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.19776877074682
Log2 mRNA fold difference:-0.71898550295774
Log2 TE fold difference:0.55286066100113
Sequences
Protein sequence

MIQLLFLVLFAEGAVALLLMVKVGPLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSS
VASILKIQNRGLKLGTVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTLRK
TSSTSREEVEKLQMENRSLREKEEKSSSETKRLQREIARLNEGMKKLKSETEEHERKASV
AEAHVDALQKQSEELLLEYDRLLEDNQILQTQLLSRG*

MIHLLFLVLFAEGAVALLLMVKVGPLRELAMRVVDQVKTGKGPATVKTLACTLSVILMSN
VASILKIQNRGLKLGTVSPMDQVLWRTHLLEASLIGYTLFLAFVIDRLHHYLQKLMTLRK
TSSTSREEVEKLQMENRSLREKEEKSSGETKRLQREVVRLNESMKKLKSEAKEHERKASV
AEAHVNALQKQSEELLLEYDRLLEDNQILQTQLLSRG*

Other information
Ka divergence:0.0739012KaKs divergence:-0.217836
GC content 1 (%):59GC content 2 (%):59GC content divergence:0
Length 1 (bp):654Length 2 (bp):654Length divergence:0
MFE 1 (kcal):-264.29MFE 2 (kcal):-255.9MFE divergence-0.016