Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G124096-GRMZM2G181453
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):RNA recognition motif family protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.22139577393202
Log2 mRNA fold difference:-0.6531414928815
Log2 TE fold difference:0.88155384448268
Sequences
Protein sequence

MDGGEDRTFKANFTSEGVTMLQDRVKEKLSELMGDYSDDTLAEYVVVLLRNGRHKDEAAK
ELHVFLGDDNDAFVSWLWDHLSSNLHLYVQPKAASSKDDTRSSHNAARGLPVHSVISSTQ
VNHEPEAETQKTVITHKKKDWGHRKRDWGTIGRGQSETVPLRSVVDNVSLAKEKDLHESH
ADEKAFHKSHSVRRTRSPDMHNHRKRSREADVRSTKSATHPVNGAPRRLLQFAVRDAVRT
VPPVTSGSESASKRLCSVVSTLASDSTLDITHIRLQKTNSDLRIPVATAALRAAAEAAED
ALKDSFCGSVFSRLGRMPTINSSEQSPDRRSQDLEGKEYENIDNIQAENQVEFYGRNQHG
GSDVYMRDRRTEEATGSLSNIDEYGHNSSVRYNGLGSLRSALPASGGKESLVLGYVRGAS
EVRSGRLIAQGPPAGSGPRSSEKILNVSGNTKTQKLRTHVTRDALAFDPQVPMEKVSGAR
KSIGQGPHAGSGPRPSERILNVSGNTNTQKLPTHVTRDDLAFDPQVPMEKVADARKSHVK
IAHANDMSMTTDKSKDLIQSSSMLEAQKATSGAAGSNTTGQPEGGSDSRTVFVSNVSAPL
LFCL*

MDGGEDRTFKANFTGEGVTMLQDRVKEKLRELMGDYSDDTLAEYVVVLLRNGRRKDEAAK
ELQVFLGDDNDAFVSWLWDHLSSNLHLYVHAKSASSKDDVKSTHSAARGLPVHSVTSSMQ
VNHEPEAETQKTVVTHKKRDWGHQKRDWGTIDRGQSEAVPLRSVVANVSHVDEKDFHKSH
ADEKAFHKSHSLRRTRSPDMHNHRKRSREADVQSTKRSSHPVVSAPRRLLQFAVRDAVRT
VQPVTSSSESDSKRIRSVVSTLASDSTLDITHIRLQKTNSDLRVPGATAALRAAAEAAGD
ALKDSFSRSVFSRLGRMPTINSTEQSPYHREQDLKGKEYGNIDNIQAENQVEFDERNQHG
GSDVYMRDQRTEEATGFIPNIDEYDQNSAVRSNGLGSRQSALPASGGKESLVLGYVRGAS
EIRSRRLIAQGPHAGSGPRPSEKTQNVSGNTNMQKLPIHVTGDAVAFDHQVPMEKVADAR
KSHVKTAQANDVSMMTDKSKDLIQPSSMLQAQKASGAAGSNTTGQPEGGPDSRTVFVSNV
HFGSSKDALSRHFNKFGAVLKTHIVTDGVTGQSTGSAYIEFLHKESAEQALTLNGTSFMS
RILKVVRKSSTEVTQLPVLPRASWGSPFASRLIRTAYPRPNYPGAIRGRLSLRGAARSLQ
WKRGVADSGDVGKPSPTAPGNQLVTPATRNFTYTRTEPKTNAGAMA*

Other information
Ka divergence:-0.187354KaKs divergence:-0.305641
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1815Length 2 (bp):2121Length divergence:0.078
MFE 1 (kcal):-554.51MFE 2 (kcal):-675.55MFE divergence0.098