Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G124886-GRMZM2G141587
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383977
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.1723754237446
Log2 mRNA fold difference:-0.012955748219309
Log2 TE fold difference:-0.16555236685542
Sequences
Protein sequence

MPLRLDIKRKLAQRSERVKSVDLHPTEPWILSSLYSGSVCVWNYQTQTMVKSFEVTDLPV
RSAKFIARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTQPFVLSSSDD
MLIKLWDWDKGWVCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWSLGSPDPNFT
LDGHSKGVNCVDYFTGGDRPYLITGSDDQTAKVWDYQTKSCVQTLEGHAHNVSAVCFHPE
LPIIITGSEDGTVRMWHSTTYRLENTLNYGLERVWALGYMKGSRRVVIGYDEGTIMIKIG
REVPVASMDSSGKIIWAKHNEIQTVNIKSVGADNEIADGDRLPLAVKELGSCDLYPQSLR
HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSTDGEYAIRESTSRIKIYSKNFQ
ERKSIRPSFSVERIFGGVLLAMCTNDFICFYDWVECRLIRRIDVNVKNLYWADSGDLVTI
ASDTSFYILKYNRDVVSSHLDGGGSAAEEGVEDAFELLHEINERVRTGLWVGDCFIYNNS
SWRLNYCVGGEVTTLFHLDRPMYLLGYLANQSRVYLIDKQFNVVGYTLLLSLIEYKTLVM
RGDFDRANDVLSSIPKEQYDSVARFLESRGMLEEALEIATDTNYRFDLAVQLGRLEIAKV
IATEVQSESKWKQLGELAMSNGKLEMAEECLLHAMDLSGLLLLYSSLGDAEGINKLASVA
KEQGKNNVSFLCFFMLGKLEECLQLLIESNRIPEAALMARSYLPSKVPEIVALWKKDLQK
VNPKAAESLADPNEYPNLFEDWQIALNVEAAVAPKRVIYPPAEEYMIHAERSNENLVEAF
KNMHVQEEMVPDDNEEYVHEVIEDGGVEESQEDAVEVDAEDDGVEESQDEAVEVEAEDST
DGAVLVNGNNSEEQWGMKNEEPSA*

MPLRLDIKRKLAQRSERVKSVDLHPTEPWILSSLYSGSVCVWNYQTQTMVKSFEVTDLPV
RSAKFIARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTQPFVISSSDD
MLIKLWDWDKGWVCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWSLGSPDPNFT
LDGHSKGVNCVDYFTGGDRPYLITGSDDQTAKVWDYQTKSCVQTLEGHAHNVSAVCFHPE
LPIIITGSEDGTVRMWHSTTYRLENTLNYGLERVWALGYMKGSRRVVIGYDEGTIMIKIG
REVPVASMDSSGKIIWAKHNEIQTVNIKSVGADNEIADGDRLPLAVKELGSCDLYPQSLR
HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSTDGEYAIRESTSRIKIYSKNFQ
EKKSIRPSFSAERIFGGVLLAMCTNDFICFYDWAECRLIRRIDVNVKNLYWADSGDLVTI
ASDTSFYILKYNRDVVSSHLDRGGSAGEEGVEDAFELLHEINERVRTGLWVGDCFIYNNS
SWRLNYCVGGEVTTLFHLDRPMYLLGYLANQSRVYLIDKQFNVVGYTLLLSLIEYKTLVM
RGDFDRANDVLSSIPKEQYDSVARFLESRGMLEEALEIATDTNYRFDLAVQLGRLEIAKA
IATEVQSESKWKILGELAMSSGKLEMAEECLLHAMDLSGLLLLYSSLGDAEGINKLASVA
KEQGKNNVAFLCFFMLGKLEECLQLLIESNRIPEAALMARSYLPSKVPEIVALWKKDLQK
VNSKAAESLADPNEYPNLFEDWQIALNVEAAVASKRSIYPSAEEYMIHAERSNESLVEAF
KNMHVHEEMVPDDNEDTVHEVIEDGGVESQEDAVEVDAEDDGVEESQDEAVEVEAEGSSD
GAVLVNGNSSEEQWGTKNEEPSA*

Other information
Ka divergence:-0.199182KaKs divergence:0.0123735
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2775Length 2 (bp):2772Length divergence:-0.001
MFE 1 (kcal):-837.7MFE 2 (kcal):-859.81MFE divergence0.013