Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G125044-GRMZM2G130586
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191159
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.2784711082943
Log2 mRNA fold difference:-0.17527795922525
Log2 TE fold difference:-0.099870031486634
Sequences
Protein sequence

MSSGGGGGGARGPSGPVPASARKLVQGLKEIVNRPDAEIYAALRECNMDPDEAVSRLLSQ
DTFQEVKSKRDRKKEVKETPEPRSRGASNSSRSSRGGVDRAGRGNSVQSGSSGTDYMASR
SSILGPAVAATNAMQKPTVPSLSTNKDVVPNGSVGAQQSSSGFQHNWFGVPGQMSMADIV
KMGRPQVRSSGKPMAAGDTSYAGQTPSLSSSINQNSKQSASTALPTTFDQGFPALPDPIP
HTVNSSHGSAGNNHTHENDWFPQDDLPSGVQPTCIEASGDQSLFVASLDQSMLVADASYS
QEISHAEENNSTAVEATLSSERHLEIVEDDNHFNDGLLQNSSAYQAQVHSYVDNEVGISN
VDAESASMNFQHLSLQNEDIAATKSAEDNPAVILPDHLQAANADCAHLSFGSFESGAFSG
LLSSKVPKGSLEDDEVLIPDESRSVNRIDVRNQDYYDDDALNSSENVDVETRIGNMDNID
GPSVSESDALRQGAIDVPGLQYDLPSVSSHAYSNTTQPSTMEEPQGNTQAQPLSHFSGLL
QANTLPNNLLGSNLTPLREFDFSQFLQTQSATKYNPSVAPNNLPPISMQETSKQGGFPNT
QSTQHVPSTSISSGLPLPQQLPVYSQPTLPLGPFTSLVGYPYLPQNYYLPSAPFQQAYSS
NGPFHQSAAPAVPGAGMKYPMPQYKSSPPASTLPQPSSLSGYGGFGSANNIPGNFSQNQG
APAAPTTLGFDEALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQ
SQHGGFRQAHQPSQYGGLGYPSFYQSQTSLPQEHPQNPTEGSLNNPQGVPSQPSHQLWQH
IY*

MSGSGSGSGGGGARGQSGPVPASARKLVQGLKEIVNRPDAEIYAALRECGMDPDEAVSRL
LCQDTFQEVKSKRDKKKEVKETLDPRSRGASNSCRSSRGGMDRAGRSSSVQSGSSGTDYV
TSRSSILGPAVPVKPTVPSLSTNKDVVFNGSVGAPQSSSGFQHNWFGVPGQMSMADIVKM
GRPQVRSSGKPMAAADTSYAGQTPSLSSSVNQNSKQSASTTLPTTFDQGFPALPDPIPHT
VNSSHGSAGNNHTHENDWFPQDEPQSGVQSTGIEASGDQSLSVASLDQSMLVAGTAYSQE
NSHAEENNSTAVKATVSSERHLEIVEEDNHYNDGLLQNCAYQAQVHSYVDNEVGVSNVDA
ESAVANFQHLSLQNEDIVVTKSEDNHAVILPDHLQATNADCAHLSFGSFESGAFSGLFSS
KVTKDSLEDNEVHIPDESPSVNLDARNQDYYDNDALNLSANEDVETRIGTNMDNIDGPSV
SQSDVPRQGAIDVPGLQYDMPSVPSHAYSSTTQPSKMEDPQGNTQAQPLSHFSGLLQANT
LPNYLLGSNLTPIREFDFSQLLQTQSATKYNPSAAPNNLPAISMQETLKPGGFPNTQSTQ
HVPNTSIPSGLPLPQQLPVYSQPTLPLGPFTSLVGYPYLPQNYYLPSAAFQQAYSSNGPF
HQSGAPAVPGAGMKYSMPQYKSSPPASSLPQPSSLSGYGGFGNANNIPGNFSLNQGAPSA
PTTLGFDEALGTQFKDPNHYAALQQSDNSAMWLHGGAGSRTVSAVPPGNFYGLQGQSQQG
GFRQAHQPSQYGGLGYPSFYQSQSQASLPQEHPQNLTEGSLNNSQGVPSQPSHHLWQHSY
*

Other information
Ka divergence:-0.00613839KaKs divergence:-0.145661
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2529Length 2 (bp):2523Length divergence:-0.001
MFE 1 (kcal):-838.76MFE 2 (kcal):-848.19MFE divergence0.006