Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G125314-GRMZM2G132238
Species:maize
Duplication type:WGD
Function (paralog1):LOL3
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-5.6945225985821
Log2 mRNA fold difference:-3.989921118073
Log2 TE fold difference:-1.6410982526726
Sequences
Protein sequence

MNMGGRSPAATTIRCKYCSASLTVCAGERAIQCAQCCGVTRIRRSLSSRLPLPALTRPAS
VAGFPPCGGRGKKRAVLIGITYGGARRGCGELRGPINDVKCMRQLLCQRFAFPSDGIIML
TDDQKDPFRVPTKDNIRMAMQWLVQGCSSGDSLVFHFSGLGAQVADADCDEQDGYDEAIC
PVDSFQKGPILDDEINETIVRPLVPGAKLHAVVDACHSDSVLDLPFLCNMSRTGNWQWED
HRPPSGVCKGTSGGQAVLISGYSDGKSKFSMTPEACAAVGAMTHSFIKAVECEPQGVTYG
RLLTSMKAIMTNAGGCNQQLQGACAPARKVVNFSGVQEPNLSCSEMFDVYRKPFAL*

MRQLLCQRFAFPSDCIIMLTDDQKDPFRLPTKDNIRLGMQWLVEGSSEGDSLVFHFSGLG
AQVADDDGDELDGYDEAICPMDSFQKGPILDDEINETMVRPLVHGVKLHAVVDACHSATV
LDLPFCCNMSRSGSWQWKDESPPSGAYRGTSGGKAMLISGYSDGKAKSSVASAQKPEACA
TMGAMTHSFITAVEREPQGVTYGRLLTSMKAIMTNSGGCAVQGPIGAGAAARKVANFSGV
EEPNLSSSEKFDIYRKAFVL*

www.000webhost.com

Other information
Ka divergence:0.0880945KaKs divergence:0.0823738
GC content 1 (%):68GC content 2 (%):65GC content divergence:-0.023
Length 1 (bp):1071Length 2 (bp):783Length divergence:-0.155
MFE 1 (kcal):-514.11MFE 2 (kcal):-363.2MFE divergence-0.172