Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G125411-GRMZM2G035314
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281510
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGGEVPEPRRLSRALSFGCGGVPEEALHLVFGYMDDPRDREAASLVCRLWHRIDALSRKH
VTVGFCYAVEPARLLARFPRLESLALKGRPRAAMYGLIPEDFGAYAAPWVAELAAPLDCL
KALHLRRMTVTDEDIAVLVRARGHMLQVLKLDKCSGFSTDALCLVARSCRSLRTLFLEEC
IIEDEGSEWLHELAVNNSVLVTLNFYMTELKVEPADLELLAKNCKSLISLKMGDCDLSDL
IGFFQTSKALQEFAGGAFFEVGEYTKYEKVIFPPRLCFLGGLTFMGKNEMPVIFPYSTML
KKLDLQFTFLTTEDHCQLIAKCPNLSVLEVRNVIGDRGLEVVAATCKKLRRLRIERGDDD
PGQEEQGGVSQIGLTAVAVGCRELEYIAAYVSDITNGALESIGTFCKNLYDFRLVLLDKQ
KKITDLPLDNGVRALLRNCVKLRRFAFYLRPGGLSDVGLGYIGLYSGNIQYMLLGNVGES
DNGLIQFATGCTNLRKLELRGCCFSERALAVAVLQMPSLRYIWVQGYRASRTGQDLMLMA
RPYWNIEFAPPIPESAYRVMADGQPCVDTHAQVLAYYSLAGRRPDCPQWLVTLHPASL*

MAVLLLYAEATFLFDTGGKKPWWMLCCNCKSFFPHEKICSSFFSRSLRTLFLEECIIADE
GSEWLHELAVNNSVLVTLNFYMTELKVEPADLELLARNCKSLISLKMSDCDLSDLIGFLQ
TSKALQEFAGGAFFEVGEYTKYEKVKLPPRLCFLGGLTFMGKNEMPVIFPYSASLKKLDL
QYTFLTTEDHCQLIAKCPNLLVLEVRNVIGDRGLEVVADTCKKLRRLRIERGDDDPGQEE
QESLSDRPDSRSCRLRELEYIAAYVSDITNSGFSHQSAIGIISGFGGDDFSGIFVEGMAT
APV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):47GC content divergence:-0.087
Length 1 (bp):1797Length 2 (bp):912Length divergence:-0.327
MFE 1 (kcal):-718.82MFE 2 (kcal):-292.9MFE divergence-0.421