Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G125642-GRMZM2G319130
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280426
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.22638365215226
Log2 mRNA fold difference:-0.48361466190954
Log2 TE fold difference:0.68775210520319
Sequences
Protein sequence

MAFLNMVSHLTDLNLLSVMKRHLIRRSLSRMQNIPFRSSSQALHAVGAGLCEQPITAKSV
DVSQPIPRIEDGSDNYRLRTPYGSPPKNGLEKAFSDVMLYAVPPRGFFPSDSNAGSVHSM
SSGQSDNTNGHSRGVPMDAFRVSYSSAVSSSSHGSGHDDGDALGDVFIWGEGTGEGILGG
GGSRVGSSSGAKMDCLVPKPLEFAVRLDVQNISCGGRHAALVTKQAKLIDALSHMNIELV
ACGEYHTCAVTLSGDLYTWGDGTFKFGLLGHGNDVSHWVPKHVNGPLEGIHVSSISCGPW
HTALVTSAGQLFTFGDGSFGVLGHGDRESISVPREVESLKGLRTVRAACGVWHTAAVVEV
MSVNSNSSNCSSGKIFTWGDGDKGRLGHGDKEPKLVPTCVAALVEPNFCQVACGHCLTVA
LTTSGHVYTMGSAVYGQLGNAQADGMLPVRVEGKLYKNFVEEISCGAYHVAVLTSRTEVY
TWGKGANGRLGHGDTEDKNTPTLVEALKDKQVRNVVCGINFTAAICIHKWVSGVDQSMCS
GCRQPFNLRRKRHNCYNCALVFCHSCSSKKSLKASLAPNGNKPYRVCDTCYSKLTKGLET
DMHFSAKRAATVPGFSDTIEEDLETRSNAQLSRLSSMESFKHLDSRYSKKNKKFEFNSTR
VSPVPNGSSHWSGLNISRSFNPVFGSSKKFFSASVPGSRIVSRATSPISRRTSPPRSTTP
TPTLGGLTSPRVPTDGKPTNDALSQEVLNLRSQVESLTRKSQLLELELERTTKQLKEAIS
IAGEETAKCKAAKEVIKSLTAQLKGMAERLPGGAAKNTKLPPLPGISIPSDISSLAMESV
GSPSSSGEQIINGHNGLLASNGPSSVRNKTSHPEVGKNGSRPPDAESCHDAEWVEQDEPG
VYITLTALPGGARDLKRVRFSRKRFSETQAEQWWQENRARVYQQYNVRVVDKSTASADND
IAAN*

MSDVSLDLGGIRAGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFS
GKEEKHLRLSHISKIIPGQRTLNSIVNEQKLYVSLEVFPFSIRDEIGCLTLLTRPFFIIQ
SIFQRYPRPEKECQSFSLISHDRSLDVICKDKDEAEVWFAGLKTLISRCHQRKWRTESRS
DLLSSGATSPRTYTRRSSPLSSPFSSNDSIHKDGSDNYRLRTPYGSPPKNGLEKAFSDVM
LYAVPPRGFFPSDSNAGSVHSMSSGHSDNTNGHPRGVPMDAFRASYSSAVSSSSHGSGHD
DGDALGDVFIWGEGTGEGILGGGGSRVGSSSGAKMDCLVPKPLEFAVRLDVQNISCGGRH
AALVTKQGEIYSWGEESGGRLGHGVDCDVSQPKLIDALSHMNIELVACGEYHTCAVTLSG
DLYTWGDGTFKFGLLGHGNDISHWVPKHVNGPLEGIHVSSISCGPWHTAVVTSAGQLFTF
GDGSFGVLGHGDRESISVPREVESLKGLRTVRAACGVWHTAAVVEVMAGNSSSSNCSSGK
IFTWGDGDKGRLGHGDKGPKLVPTCVAALVEPNFCQVACGHCLTVALTTSGHVYTMGSAV
YGQLGNAQADGMLPVRVEGKLHKNFVEEISCGAYHVAVLTSKTEVYTWGKGANGRLGHGD
TDDKNTPTLVEALKDKQVRIVVCGINFTAAICIHKWVSGVDQSMCSGCRQPFNLRRKRHN
CYNCALVFCHSCSSKKSLKASLAPNTNKPYRVCDTCYSKLTKGLETDMHSSAKRAATVPG
VSDANEEDLETRSNAQLSRLSSMESFKHLDSRYSKKNKKFEFNSTRVSPVPNGSSHWSGL
NISRSFNPVFGSSKKFFSASVPGSRIVSRATSPISRRASPPRSTTPTPTLGGLTSPRVVP
NDGKPTNDALSQEVLNLRSQVESLARKSQLLEVELERTTKQLKEAISIAGEETAKCKAAK
EVIKSLTAQLKGMAERLPGGAAKNTKLPPLPGIFIPSDIPSMPTESEGSPSSSGEQIING
HNGLLTSNGQSSIRNKTSHPEVGKNGGRLPDAESCHDAEWVEQDEPGVYITLTALPGGAR
DLKRVRFSRKRFSETQAEQWWQQNRARVYQQYNVRVIDKSTASVNSDIAAN*

Other information
Ka divergence:-0.55393KaKs divergence:-0.382507
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):2895Length 2 (bp):3396Length divergence:0.08
MFE 1 (kcal):-952.8MFE 2 (kcal):-1087.72MFE divergence0.066