Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G125976-GRMZM2G074645
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272551 (LOC100272551), mRNA
Function (paralog2):hypothetical protein LOC100382470

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSSAAGGGYGAAGGAEHQHLLLGQASGQLYHVPQHSRREKLRFPPDPADSPPPTAWPAPP
PFYSYASSSTSSYSPHSPTLAHTQLVAHALPAGAGAQIPSQNFALSLSSASSNPPPAPRR
QLAAGVAAGPYGPFTGYAAVLGRSRFLGPAQKLLEEICDVGGRPPHLDRRSDDEGMLDMD
AAGGVDHEMDGGDCATAEAVAVSGAEQQWRKTRLISLMDDVCRRYKQYYQQLQSVISSFE
TVAGLSNAAPFAFMALRTMSKHFKCLKGMVMSQLRNTSKVIANHGIIAKDDMANFALMGG
GAGLLRGNSVNAFSQPHNIWRPQRGLPERAVSVLRSWLFEHFLHPYPTDSDKQMLAKQTG
LTRNQVSNWFINARVRLWKPMVEEIHNLEMRQLHKTTSVDQNQLGMQQQNHHSSDGSGRP
SSDPSNSQRGQSSGMTRNLSSRAPRHIQDDELSQMPHDMAGQVSFAYSGLPPAHHGLALS
HHHHPQQAQAEAVGVGGVAASSGGGVSLTLGLHQNNNNNRAYIAEPLPAALPLSLPHRFG
LEDVSDAYVMGPFGGQDRHFSKGIGGGHNLLHDFVG*

MSSAAGGGYGAGGAEHQHLLLGQAAGAGQLYHVPQHSRREKLRFPPDDAADSPPPTAWPA
PPPFYSYASSSTSSYYSPHSPTLAHAQLVAHALPAGAGVQIPSQNFALSLSSAPSNPPPA
PRRQLAAGVATGPYGPFTGYAAVLGRSRFLGPAQKLLEEICNVGGRPPHLDPLSDEGMFG
MEHGMGGVDRATAEAVAVSGAEQQWRKTRLISLMEDVCRRYKQYYQQLQSVISSFETVSG
LSNAVPFASMALRTMSKHFKFLKGMIMSQLRNTSKVAASDGIGKDDMANFALMGGGADHL
RGNSVNTFSQAHNIWRPQRGLPERAVSVLRSWLFEHFLHPYPTDSDKQMLAKQTGLTRNQ
VSNWFINARVRLWKPMVEEIHNLEMRQQLQKNTSAVDKTQLGMQQLIQHSSANSRQRGQS
SGGTTRNQDELPPRMPHDMAGQGQQQQQQVSFAYAGLPAHHHGLALSHPQQQAEAVSAVG
GGVSLTLGLHQNNNRTYVAEPLPAALPHRFGLEDVSDAYVMQGTTSFGGQDRHFGKGMGG
HHFVHDLVG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):64GC content 2 (%):64GC content divergence:0
Length 1 (bp):1731Length 2 (bp):1650Length divergence:-0.024
MFE 1 (kcal):-792.71MFE 2 (kcal):-748.3MFE divergence-0.029