Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126019-GRMZM2G145827
Species:maize
Duplication type:WGD
Function (paralog1):dynamin-related protein 1C
Function (paralog2):dynamin-related protein 1C

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.37941931546547
Log2 mRNA fold difference:-0.17278951241898
Log2 TE fold difference:0.57546496931505
Sequences
Protein sequence

MATMESLIGLVNRIQRACTVLGDHGGGGGEGSLWEALPSVAVVGGQSSGKSSVLESIVGR
DFLPRGSGIVTRRPLVLQLHKTDGGHEYAEFLHAPRKRFTDFAAVRKEIADETDRITGKT
KAISNVPIHLSIYSPHVVNLTLIDLPGLTKVAVEGQPESIVQDIENMVRAYVDKPNCIIL
AISPANQDIATSDAIKLARDVDPSGDRTFGVLTKLDLMDKGTNAVDVLEGRQYRLQHPWV
GIVNRSQADINKNVDMLSARRKEKEYFESSPEYGHLAHKMGAEYLAKLLSQHLEAVIRAK
IPSIIAMINKTIDEIEAQLDRLGRPIGGDAGAQLYTILDMCRAFDRVFKEHLDGGRPGGD
RIYGVFDNQLPAALKKLPFDRHLSMQNVRKVISEADGYQPHLIAPEQGYRRLIDSSLSYF
KGPAEASVDAVHLVLKELVRRSIAATEELKRFPTLQSDIAAAANDSLERFREDGRKTVLR
LVEMEASYLTVEFFRKLPTEPEKAADKNTPVSDRYQDNHLRRIGSNVSSYINMVCETLRN
TVPKAIVHCQVKEAKRNLLNRFYAHVGSKEKKQLSAMLDEDPALMEKRDALVKRLELYKS
ARNEIDSVAWK*

MATMESLIGLVNRIQRACTVLGDHGGGGGEGSLWEALPSVAVVGGQSSGKSSVLESIVGR
DFLPRGSGIVTRRPLVLQLHKTDGGHEYAEFLHAPRKRFTDFAAVRKEIADETDRITGKT
KAISNVPIHLSIYSPHVVNLTLIDLPGLTKVAVEGQAESIVQDIENMVRSYVDKPNCIIL
AISPANQDIATSDAIKLARDVDPSGDRTFGVLTKLDLMDKGTNAVDVLEGRQYRLQHPWV
GIVNRSQADINKNVDMLSARRKEKEYFESSPEYGHLAHKMGAEYLAKLLSQHLEAVIRAK
IPSIIALINKTIDEIEAQLDRLGRPIGGDAGAQLYTILDMCRAFDRVFKEHLDGGRPGGD
RIYGVFDNQLPAALKKLPFDRHLSMQNVRKVISEADGYQPHLIAPEQGYRRLIDSSLSYF
KGPAEASVDAVHLVLKELVRRSIAATEELKRFPTLQSDIAAAANESLERFREDGRKTVLR
LVEMEASYLTVEFFRKLPTEPEKAADKNTPVSDRYQDNHLRRIGSNVSSYINMVCETLRN
TIPKAVVHCQVKEAKRNLLNRFYAHVGSKEKKQLSAMLDEDPALMEKRDALVKRLELYKS
ARNEIDSVAWK*

Other information
Ka divergence:-0.657379KaKs divergence:-0.999991
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1836Length 2 (bp):1836Length divergence:0
MFE 1 (kcal):-622.43MFE 2 (kcal):-615.12MFE divergence-0.006