Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126038-GRMZM2G145854
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280404
Function (paralog2):hypothetical protein LOC100191453

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.24899959699822
Log2 mRNA fold difference:-0.2077453553347
Log2 TE fold difference:0.45593829058688
Sequences
Protein sequence

MAFLARALRQSNWRLSSRCPAVAASCRWISPTAAAGSPEAGAAVAPADLELPPPREPVGG
ARVELPPNPEDALEVFVDGHAVRIPKGFTVLQACEVAGVDIPRFCYHSRLSIAGNCRMCL
VEVEKSPKPVASCAMPALPGMKIKTNTPVAKKAREGVMEFLLMNHPLDCPICDQGGECDL
QDQSMAFGADRGRFTEMKRSVVDKNLGPLVKTVMTRCIQCTRCVRFATEVAGVQDLGMLG
RGSGEEIGTYVEKLMTSELSGNVIDICPVGALTSKPFAFKARNWELKGTETIDVTDAVGS
NIRIDSRGPEVMRVVPRLNEDINEEWISDKTRFCYDGLKRQRLNDPMIRGPDGRFKAVTW
RDALAVIAEVLHQVKPEEITGVAGKLSDAESMMALKDFVNRMGSDKVLCEGNGPNPPADL
RSNYLMNTSIAGLEKADVFLLVGTQPRVEAAMVNARIRKTVKATQAKVGYIGPPADFNYD
HEHLGTGPQTLVEIAEGSHPFCSVLQSAKNPVIIAGAGLFEREDQVALFSTIETVAKKFN
VMRPDWNGLNVLLLHAAQAAALDLGLVANPAESIKSAKFLYLMGADDISLEKLPDDAFVV
YQGHHGDKGVYRANVILPSSAFSEKEGTYENTEGCTQWTIPAVPTVGDARDDWKIIRALS
EVAGAQLPYDSLSAVRDRISTVAPNLVHVDERETPTISAEVKPPVKQQVSSTPFKAVVEN
FYMTDAITRASKIMAQCSATLLKK*

MAFLARALRQSNSRLSSCPSVAASCRWISRTAAAGSPEAGAAVAPADPELPPPREPVGGA
RVELPPNPEDALEVFVDGHAVRIPKGFTVLQACEVAGVDIPRFCYHSRLSIAGNCRMCLV
EVEKSPKPVASCAMPALPGMKIKTNTPVAKKAREGVMEFLLMNHPLDCPICDQGGECDLQ
DQSMAFGADRGRFTEMKRSVVDKNLGPLVKTVMTRCIQCTRCVRFATEVAGVQDLGMLGR
GSGEEIGTYVEKLMTSELSGNVIDICPVGALTSKPFAFKARNWELKGTETIDVTDAVGSN
IRVDSRGPEVMRIVPRLNEDINEEWISDKTRFCYDGLKRQRLNDPMIRGPDGRFKAVTWR
DALAVVAEVLHQVKPEEITGVAGKLSDAESMMALKDFVNRMGSDKVLCEGNGPNPPADLR
SNYLMNTSIAGLEKADVFLLVGTQPRVEAAMVNARIRKTVKATQAKVGYIGPPADFNYDH
EHLGTGPQTLVEITEGRHPFCSVLQSAKNPVIIAGAGLFEREDQDALFSMIETVAKRFNV
TRPDWNGLNVLLLHAAQAAALDLGLVANPAESIKSAKFLYLMGADDISLDKLPDDAFVVY
QGHHGDKAVYRANVILPSSAFSEKEGTYENTEGCTQWTIPAVPTVGDARDDWKIIRALSE
VAGALLPYDSLSAVRDRISTVAPNLVHVDEREPSTISVEVKPPVKQKVSSTPFKTVVENF
YMTDAITRASKIMAQCSATLLKK*

Other information
Ka divergence:-0.234857KaKs divergence:-0.18481
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):2235Length 2 (bp):2232Length divergence:-0.001
MFE 1 (kcal):-827.44MFE 2 (kcal):-823.87MFE divergence-0.002