Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126062-GRMZM2G132875
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274507
Function (paralog2):hypothetical protein LOC100191526

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.26631632475695
Log2 mRNA fold difference:-2.5513073052091
Log2 TE fold difference:2.2604454488142
Sequences
Protein sequence

MASAGTTAVVPEVALRSGNARTAMPMVGMGTASFPLVHEAVKDGVLSAIEVGFRHFDTAS
MYGTEKPLGDAVAEALRRGTLRSREDLFVTSKLWCSQNHPDLVLPSLRETLKNLQMEYVD
LYLIHWPVCLKPGPPELPTRKENAVPLDLAGVWRAMEECQRLGLAKAIGVSNFTTRHLDG
VLAVATVPPAVNQVELNPAWQQRTLRAYCADRGIHVAAYSPLGGQNWDGQGSAVLDSEVL
AAIAKARGKTVAQVALRWIHEQGVTCIVKSYSKERLRQNLGIFDWELTDEERLKISQIPQ
RKVVQTSSLFSQEGEFTAVDPAELNILEE*

MASTGTTAAAVPEVTLRSGNGKPMPMVGMGTASFPVVHEAVRDAVLAAIEVGFRHFDTAF
LYGTEKPLGDAVAEALRRGLLRSREELFVTSKLWCSQTHADLVLPSLRETLENLQMEYVD
LYLIHWPVCLRPAGGPPKFPNRKEDAVPLDVAGVWRAMEECQRLGLARAIGVSNFTTRHL
DKVLAIAAVPPAVNQVELNPAWQQRTLRAYCADRGVHVAAYSPLGGQNWDGRGNAVLDSE
VLAEIARARGKTVAQVSVTLAAGCVFWRAVAVSWTFAPAGEGLVDHAFVVYCLVCHTILF
SFAFVFPYYQVALRWIHEQGVTCIVKSYNRERLKQNLEIFDWELTDDDRLKISHIPQRKV
VEASGLFSQEGEFTSVDPAELNIVEE*

Other information
Ka divergence:-0.102633KaKs divergence:-0.273746
GC content 1 (%):66GC content 2 (%):66GC content divergence:0
Length 1 (bp):990Length 2 (bp):1161Length divergence:0.079
MFE 1 (kcal):-476.8MFE 2 (kcal):-588.8MFE divergence0.105