Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126170-GRMZM2G111204
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273133
Function (paralog2):hypothetical protein LOC100279552

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGRPPSTTGAPAFRFLPSEVAEMEARLLQLNNGIPTRAMLQTLADKFSASPERAGKVAIQ
PKQVWNWFQNRRYSHRAKTTRVVPSPPAKMTPSGADHHQHAANASAFRAAQPSSVAVAHH
GSSSTGKNPMEGVSVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEW
INVRKCVRQRSLPCEATECVAVLPGDLILCFQEDKEQALYFDARVLDAQRRRHDVRGCRC
RFLVRYDHDSSEEIVPLRKVCRRPETDYRLQILHAARAAAASADIHTPPREAKVELASNA
KSPYEQKPQKQYKMMDVNTDEEVTMVSTLEQDETQGKTVAPVPSATAETRNSSSDAVMKD
AEASSVAQDDDEVQVVDKMKEG*

MGRPPSAGAPAFRFLPSEVAEMEARLLQLNNGIPTRAVLQTLADKFSASPERAGKVAIQP
KQVWNWFQNRRYSHRAKTPRAASSPPAKMTPSGADHHQHAANASAFRAAQLSSVAAAHHG
SSSTGKNPVESVSVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWI
NVRKCVRQRSLPCEATECVAVLPGDLILCFQEGKDQALYYDAHVLDAQRRRHDVRGCRCR
FLVRYDHDSSEEIVPLRKVCRRPETDYRLQILHAARAAATNADVHTPPKEVKVELASTDK
SPAEQKPHKQHKMMDVNTDEVTMVSTLEQDETPGKTVAPVPSATAETRNSSSDTVMKGAE
ASSVVEDDDEVQAVDKMKEG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):55GC content 2 (%):55GC content divergence:0
Length 1 (bp):1149Length 2 (bp):1143Length divergence:-0.003
MFE 1 (kcal):-434.1MFE 2 (kcal):-428.32MFE divergence-0.007