Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126182-GRMZM2G100819
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):sm protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEGPPGLSQAIPVSGDAYCNSSTTHVDAAGSSSPAVAKLRKLLFRRMLIGVNDGRYFHGL
FHCIDKQGNIILQDAVEYRSARHCLPPTEHRCLGLILIPAACRSSCQVDCSVEEKMSLMC
LE*

MEEGAPGPSQAIPDSGDTYRNSSTAPVGSSSPSVAKLRKLLFRRMLIGVNDGRYFHGLFH
CIDKQGNIILQDAVEYRSARHCSPPTEQRCLGLILIPAACRSSCQVDCSVEEKMSLLCFE
*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):61GC content 2 (%):64GC content divergence:0.024
Length 1 (bp):369Length 2 (bp):363Length divergence:-0.008
MFE 1 (kcal):-149.2MFE 2 (kcal):-149.11MFE divergence0