Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126197-GRMZM2G049027
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDDGDGGLSFDFEGGLDSAPAAGGPVPSSTDPGAGGGDGPGMHGRGRGRGSYRQTVCRHW
LRGLCMKGEACGFLHQFDKARMPVCRFFRDFGECREPDCAYKHSYDDVKECNMYKMGFCP
NGPNCRYKHIKLPGPPPSVEEVLQKILQMRSFNRYSQNRNSNYNQQGERPQHPQGSALPN
QNSAENATAAAPPAGGQQAQTLNQQPPQQQQKPNTNDQAQGVSNGHQATRIATPLPQGPS
RCVWSF*

MDDSDGGLSFDFEGGLDSAPASGGGGPVPSSTDPGAGVGGGGDGLGMHGRGRGRGSYRQT
VCRHWLRGLCMKGEACGFLHQFDKARMPVCRFFRDFGECREPDCAYKHSYDDVKECNMYK
MGFCPNGPNCRYKHIKLPGPPPSVEEVLQKILQMRSFNRYSQNRNNNYNHQGERPQHPQG
SGLPNQNSAENATAVDPPAGGQQAQTLNQQPPQQQQKPNTNDQAQGVSNGHQATRIATPL
PQGPSRCVWSF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):58GC content 2 (%):57GC content divergence:-0.009
Length 1 (bp):741Length 2 (bp):756Length divergence:0.01
MFE 1 (kcal):-310.7MFE 2 (kcal):-306.5MFE divergence-0.007