Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126447-GRMZM2G116314
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLQPREADVPALFLVFIVLPVVAYFLLGRWHDSASKKARASVLAQRAAEEAYREETMACP
DIIPPGPSLRTMPYFKPAPSLRQEYHECATCHAPAKTRCSRCKSVRYCSGKCQIVHWRQG
HKETCQKWLGSGSSSFGGSSTEATEQMPFLANLNSPLPGGDIHLRDMNFDTLSEPSFPTT
DGYNLDTDPFPADRSNMNRSNQGIHMSENGAVGVSFEKNNYNAADEIHSSEILSGNKVSN
NYFGSDAMSGNGDATYPAKSNAQQPSSCAPDVRKQSKASITVYQPDMSVYLTSDMVSSCE
GSYVSAGEPLQRSLSSGRTIGKVTVVNKRPSYPSSKVVSAQKSQDKVSTSYQNDAHEKNP
CNKNDQRSTPTCESSQSTSSNLLKSGTSKVEVLKKPSKFLKTSLVALINDNKRNKVLFPY
EDIVKFFQYEARGVSPRGLFNCGNRHLVMSMQAACLDGLGGEKHVEPSLQETTLIQQMFG
GRLKSKVKCLRCYHESERYENIMDLTLEIHGWVESLQDALTQFTAPEDLDGDNMYKCGRC
SAYVKARKQLSVHEVPNILTVVLKRFQSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLY
FLYAVVVHVDTENASFSGHYISYVKDMQGTWLRIDDSEVQVVSVNQVMSEGAYMLFYLRS
FPRPPRIYIEKGLPVTSAKRHTSKSSKGSKHDRKQTELLFPANDQAYGVYDFRPDGEGYA
QDQHAELRSRAFHHADDAFADSVSADFSEATSSEWSLFTSSDESSFTTESTRDSFSVVDY
GDNAGLDPISSIFGPSYAPEHGAPGSFVSRTRFSPSSPQTRYFSESTGFVSDSSMPAHPH
GIVHRGRYPDSRACASSAEPLASAAHQRSGYGRYPLSRDGFVQTSGFCQM*

MCELEQYASTLRESGGPLSPSRILSNLRNIGCRLGGGTQEDAHEFLRHLVMSMQAACLDG
LGGEKHVEPSLQETTLIQQMFGGRLKSKVKCLRCYHESERYENIMDLTLEIHGWVESLQD
ALTQFTAPEDLDGDNMYKCGSCAAYVKARKQLSVHEVPNILTVVLKRFQSGKYGKINKCV
TFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKDMQGTWLRIDDSE
VQVVSVNQVMSEGAYMLFYMRSFPRPPRIYIEKGPTVPSAKRHTSKYSKGSKHEREQTEL
LLSANDPAYGVYDFRPDGEGYTQDQQAELRSRDFHRADDAFADSVSADFSEATSSEWSLF
TSSDESSFTTESTRDSFSVVDYGDNAGLDPISSIFGPSYAPEHHPGPPGSFAACTRLSPS
NPQTRYFSESTGFVSDYSSSGIVHRGRDPGRAYTCSAEPLASAAAAHQHQRYALSGRDGL
VQTSGFCQM*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):49GC content divergence:0.032
Length 1 (bp):2673Length 2 (bp):1470Length divergence:-0.29
MFE 1 (kcal):-873.77MFE 2 (kcal):-514.17MFE divergence-0.259