Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126471-GRMZM2G086789
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277035
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGGGVMRTAAKVGIARGAAAVAAAKGGRFRHAAPAFATAPAATGSDAAPLVSASGGEVPP
AAAQWAASWELDDWEFADCGDVAPAAVVAEREATAAAAKPRLVFAPPSREEAEEATTELR
DAIGRAYFNESPVEVVKEQDKEFNKLATDAIIPSMPGHVVQAFTLLKSSTEAQSVVASLA
SDRNVWDAVLKNEKVMEFYKTHQTTPVQTFPEEAATAESPGKFEDATSENASNSELPTGS
GASFADFVDNAKKKVMDVVHNITDFFRDLFNDSAEAQTGAGPSAEKGFSATEMAVGGSFM
ALTIAVILVVLFKRA*

MGGGVMRTAAKVSIAGGAAAAKSGRFRNAAPVFATAPAAAGSEAAPLVSVSSGEVPPAAA
QWAASWELDDWEFADWRDDAAAAAAVVEREATAAAAKPRLVFAPPSREEAEEATTELRDA
VERAYFNESPVEVVKEQDKEFNKLATDAMIPSMPGHVVQAFTLLKSSTEAQSVVASLASD
RNVWDAVLKNEKVMEFYKTHQTTLVQTSPNEAVTVELPGKLEDAASENTSSGELPAGSGL
SFSDFVDNAKKTVMDVVHNITDFFKDLFDDSAKTQTGAGPSAAEKGPSMADMAVGGSFMA
LAIAVILVVMFKRA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):58GC content 2 (%):59GC content divergence:0.009
Length 1 (bp):948Length 2 (bp):945Length divergence:-0.002
MFE 1 (kcal):-413.74MFE 2 (kcal):-411MFE divergence-0.003