Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126572-GRMZM2G146422
Species:maize
Duplication type:WGD
Function (paralog1):transposon protein
Function (paralog2):transposon protein (LOC100284963), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.44403095421323
Log2 mRNA fold difference:1.2574077929586
Log2 TE fold difference:-1.7101316857506
Sequences
Protein sequence

MRCKKHPYQVGGGGVCATCLRDRLIALEAAQNGDASSSPPPPAAAPAFPRSVSPYVSRRK
SDTSGGGGALRHHPSLLFFRTPQVGPAYGGGALEEGDIGYEYKRRRAGKFSVLATLFGHH
HGHRSEETHQEGATERKKHSWFAAIMPRRRKKQAAPASITSPRSAPPRRSCRVVSNRGLS
PERDSHGSGDESSSPAADPPWRPSPSPMRRTRCRRRQTNSMPSGFAVCLSPLVRPSPGRR
RHVQPPDPGSFSSEFRPSPLHSLSSAASVTRCRSRKLADVGRFR*

MRCKRHPNQAGGGVCATCLRDRLLALEAAQSGDASPPGPAQAQAPEPPPAFPRSVSPYVS
RRKSDTSGGALRHHPSLLFFRTPQVGPAYGGGGGGGALEEPHIGYGYGYGHEKRRAGKFS
VLATLFGRHHHHRRPEARHQERKKHSWLAGIMPRRRRSKGQVPASATSPQSAPPRRSCRA
VSNRGLSPERDGDGDDDESSSPAAWRPSPSPMRRTTCRRRQTSGSMPSGFAVCLSPLVRP
IPGRRPVQPPDPGAFSSELRPPPPPPLHSSLSSASVTRCRSRKLADGGRFR*

Other information
Ka divergence:0.355751KaKs divergence:-0.0402881
GC content 1 (%):73GC content 2 (%):76GC content divergence:0.02
Length 1 (bp):855Length 2 (bp):876Length divergence:0.012
MFE 1 (kcal):-451.4MFE 2 (kcal):-484.9MFE divergence0.036