Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126580-GRMZM2G081180
Species:maize
Duplication type:WGD
Function (paralog1):structural constituent of ribosome
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASLHPTTAMLAQRHSPAPSLSASSLSWSASIAVSRIPPAPGLALHPLVNPPASGNRQSP
VVCAAWTRRSRGEAEQRPNRKSWKQRTDMYMRPFLLNVFFSKRFVHAKVMHRGTSKVIAV
ATTNSKDLRLTLPSLVDDNACRTIGRLIAERSMDADVFAMAYEPKKNERIEGKLGIVIDT
IKEHGIIFV*

MASLHPTTAMLLAQRHSPAPSLRSQHIVALMVCLRSHLQHRVGPWPRSLLTGPASGNRQS
TVVCAAWTRRSRGETEQRPNRKSWKQTCTCAPSCSIFFPSKRFVHAKVMHRGTSKVIAVA
TTNDAKDFRLTLPSLVDDNACRTTGRLIAERSMDADVFALAYEPKKNESREQAWHRD*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):63GC content 2 (%):62GC content divergence:-0.008
Length 1 (bp):570Length 2 (bp):534Length divergence:-0.033
MFE 1 (kcal):-228.4MFE 2 (kcal):-203.7MFE divergence-0.057