Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126603-GRMZM2G114895
Species:maize
Duplication type:WGD
Function (paralog1):LIN1 protein
Function (paralog2):hypothetical protein LOC100272242

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATAAKTLARAGSSLFGRILASPSIIRPGLPLAGLRPHFPPPAPAGLDAYEAETVARLSS
LPGEISFPCGLPSLRFFIDDVEDPVANDPLQLLPKRTYQPSTIKRKRTHGFLTRKSTKGG
RKVIARRIAKGRHRISV*

MASAAKTLARVGSSLFGRILASPSSSIPRAGLPLARLQPHVPPPAPAGVDAYEAETIARL
SSLPGEISFPCGLPSLRFFIDDVEDPVPNDPFQLLPKRTYQPSTIKRKRTHGFLTRKSTK
GGRKVIARRIAKGRHRISV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):61GC content divergence:-0.008
Length 1 (bp):414Length 2 (bp):420Length divergence:0.007
MFE 1 (kcal):-145.91MFE 2 (kcal):-154.18MFE divergence0.028