Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126706-GRMZM2G427090
Species:maize
Duplication type:TD
Function (paralog1):ribonuclease P
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.74300114641066
Log2 mRNA fold difference:-0.50436573060966
Log2 TE fold difference:-0.20793388049225
Sequences
Protein sequence

MSKKRKHLDPANSLKDSEQVVASDFIRGDDLDDLLSKLIRSVEIAKASRGGLPEKIWMKQ
QFAIGVNDVTRVLERMPHSVTAHPAQMSNEAPTVSGRRQAPLVPLQAVLVAADCNPKWLT
KHIPTLASTRQVPVLCVKDNKGGSVRLGHVVNVRTALAIGVKAKDSVLNKTIDEFLKDSK
LVANEP*

MSKKRKHLDPANSLKDSEQVVASDFIRGDDLDDLLSKLIRSVEIAKASRGRLPEKIWMKQ
QFAIGVNDVTRVLERMPHSVTAHPAQMSSEAPTVSGQRQAPLVPLQAVLVAADCNPKWLT
KHIPTLAFTRQVPVLCMKDNKGGSVRLGHVVNVRTALAIGVKAKDSVVNKTIDEFLKDSK
LVANEP*

Other information
Ka divergence:0.277716KaKs divergence:0.06661
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):561Length 2 (bp):561Length divergence:0
MFE 1 (kcal):-164.5MFE 2 (kcal):-164.9MFE divergence0.001