Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G126827-GRMZM2G163813
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191346
Function (paralog2):hypothetical protein LOC100193507

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.19054692748761
Log2 mRNA fold difference:0.12418879834886
Log2 TE fold difference:-0.30974509557762
Sequences
Protein sequence

MEWTAPKPASSPPLLWDWGDHAATGSGSSSDAPARRGGKEREAKRARAGEDRGGGELRCQ
VEGCGLDLSRVKDYHRKHRVCEAHTKSPRVIVAGQERRFCQQCSRFHALSEFDQKKRSCR
RRLSDHNARRRKPQPDAFTFASAKLPSTLFDDRRQISFVWNKAPVSHVRPFTSPWDSSSD
LKPPYAKEISDVSTKVGTITGQVHLDKSHMFNAIPTLSHGKDEPWPMKGLDMSISASKFD
GAADLQHALSLLSAGACGLPDSVHQTSCIIQFNGASENSSDLHVTHGRNSGPASCADAQH
IAAQPQSQLFHFTTDTGNTVYEPSFFGVNQIN*

MEWTAPKRAASPPSPPLLWDWGGDHAGATGSGSGSSGDAPARRGGREREAKRARADDGEV
RCQVEGCGLDLSRVKEYHRKHRVCEAHTKSPRVVVAGQERRFCQQCSRFHALSEFDQKKR
SCRRRLSDHNARRRKPQPDAFAFASARLPSSSFDDRRQISFVWNKAPVSHPFTSPWDSSS
ELPHAKEIREVSTKVGTITGQVHLDKSYVSNAVPSLTHGKDEPWPMKGPDMSIAASKFDG
APDLQRALSLLSVGACGLPDPVHQTSCVIQFTSASENSGDLHLSHGANSGLASCGDGQHI
ASQPQAQLVRFTMDTSNSVYEPSFFSVNQIN*

Other information
Ka divergence:-0.250819KaKs divergence:-0.35907
GC content 1 (%):55GC content 2 (%):57GC content divergence:0.018
Length 1 (bp):999Length 2 (bp):996Length divergence:-0.002
MFE 1 (kcal):-389.3MFE 2 (kcal):-400.33MFE divergence0.014