Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G127117-GRMZM5G805609
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279952
Function (paralog2):glucan endo-1,3-beta-glucosidase 7

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.12085102715835
Log2 mRNA fold difference:-2.1229469241253
Log2 TE fold difference:2.1454260443664
Sequences
Protein sequence

MGLRVRASSLLLSLAIELAAVLVSVSAQQKFGINYGQIANNLPDPTQVATLLRSMNVNKV
KLYDADPRVLTAFANTGVEFIIAVGNENLQTMAGSPAAARQWVAANVRPYIPATRITCVT
VGNEVFSGNDTATMASLLPAMKAVHAALADLGLGGQATVSSAHSVNVLAASFPPSSGAFR
EDLAEYMKPILDFHAQTGSPFLINAYPFFAYKASPGSVSLPYVLFEPNPGVRDPSTGLSY
DNMLYAQIDAVYAAMKAMGHTDVGVRISETGWPSRGDEDETGATVQNAAAYNGNLMQRVA
MSQGTPLKPNVPVDVYVFALFNENMKPGPTSERNYGLFYPNGSPVYALSAGSGGGSGPGG
SLNPYYTSMFSSSSRSAVSATFLTERVMLLLLLQATVILRHYC*

MGGEAGMGLRVRASSLLLSLVLELAVALVSVSAQHKFGINYGQIANDLPDPAQVATLLQS
MGVNKVKLYDADPRVLTAFANTGVGFTIAVGNEDLQAMAASPDAARRWVAANVQPYVPAT
RITCVTVGNEVLSGNDTAAMASLLPAMRAVHAALGDAGLGQPVAVSSAHSVDVLATSFPP
SSGAFREDLAGYVRPILDFHAQTGSPFLVNAYPFFSYKASPGPGPGGVSLPYALFQPNPG
VRDPGTGLTYDNMLYAQIDAVYAAMQAAGGRADVGVTVSETGWPSRGDDDEPGATAQNAA
AYNGNLMRRVAAGQGTPLRPAVPVDVYVFALFNEDLKPGPTSERNYGLLYPDGSPVYALD
AGGPGPGGSLNPYYTSMFSSSSSSGSAVGVTFLTEKVVLSLLLQAIVILRRSHSYC*

Other information
Ka divergence:0.714427KaKs divergence:0.0578512
GC content 1 (%):67GC content 2 (%):70GC content divergence:0.022
Length 1 (bp):1212Length 2 (bp):1251Length divergence:0.016
MFE 1 (kcal):-555.5MFE 2 (kcal):-650.4MFE divergence0.079