Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G127139-GRMZM2G136344
Species:maize
Duplication type:WGD
Function (paralog1):zeaxanthin epoxidase
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.71125845726387
Log2 mRNA fold difference:1.5024297483066
Log2 TE fold difference:-0.77874575138437
Sequences
Protein sequence

MALLSATSPAKAHLPTLLAYHDEPQQHQHALPPAHPQCFGGGGGKARQRARGRCAAAMRP
LDAAVAPAPTPAAGEAPRKRPRVLVAGGGIGGLVLALAARRKGYDVTVFERDLSAVRGEG
QYRGPIQIQSNALAALEAIDMSVAEEVMRVGCVTGDRINGLVDGMSGSWYIKFDTFTPAA
ERGLPVTRVISRMTLQQILARAVGDDAILNGSHVVDFIDDGSKVTAILEDGRKFEGDLLV
GADGIWSKVRKTLFGHSDATYSGYTCYTGIADFVPPDIDTVGYRVFLGHKQYFVSSDVGA
GKMQWYAFHNEEAGGTDPENGKKKKLLEIFDGWCDNVIDLINATDEEAVLRRDIYDRPPT
MNWGKGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELENAWQESVKTETPIDIVSSL
RRYEKERRLRVAIIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRFFIK
YGMPTMLSWVLGGNSSKLEGRLLSCRLSDKANDQLYQWFEDDDALEEAMGGEWYLIATSE
GNCNSLQPIHLIRDEQRSLFVGSRSDPNDSASSLSLSSPQISERHATITCKNKAFYLTDL
GSEHGTWITDNEGRRYRVPPNFPVRFHPSDVIEFGSDKKAMFRVKVLNTLPYESARSGNR
QQQQVLQAA*

MDIVSSLRRYEKERRVRVAVIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRV
GGRFFIKYGMPAMLSWVLGGNSSKLEGRPLSCRLSDKAHDELYRWFDDDDALEQAMGGEW
YLFATSEANNNSLQQPIRLIRDEQRSLSVGSRSDANDSASSLSLPFPQISERHATITCKN
KAFYLTDLGSEHGTWITDNEGRRYRVPPNFPVRFHPSDVIEFGSDKKAMFRVKVLNTLPY
ESARSGKQQGLQQEQVLQAA*

Other information
Ka divergence:-0.170107KaKs divergence:-0.230087
GC content 1 (%):53GC content 2 (%):48GC content divergence:-0.05
Length 1 (bp):2010Length 2 (bp):783Length divergence:-0.439
MFE 1 (kcal):-771.73MFE 2 (kcal):-249.8MFE divergence-0.511