Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G127299-GRMZM2G351382
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.17239829978683
Log2 mRNA fold difference:-0.40445938397587
Log2 TE fold difference:0
Sequences
Protein sequence

MGKTNRFSKGHQLGFVPDYRHGVEAMGESKGLGSPPRIDSGSSCAPPKRKCVSVNSEEGE
GASGFSMPRAREVFSLPRMTRLDKKDLEMKLRHELAQVRDVQSRLFLRGSAVSMNGAAVA
SVPAGDVQPKKKVEKLKRSDSVQTDRGAPPPAATVVAAPVASSVNYTSSFKQCANLLKSI
MSHVWAGPFLVPVDIVKLNIPDYFQIVKQPMDLGTIQKKLKAGMYSTPREFAADVRLTFS
NAMNYNPVNNDVHLMAKTLSKNFETRWKLIEKKLPKPDDKPQPVEKPPVREPTEKNSTKG
VAVEKEDITKKKPSKKSVPKQDIFQEGYSADNPVLQPKKRKTSPLIQDASLVEDVVPTGK
RMMTSEQKYDISARLQSFGAFIPDHVVEFIRSRVDDCDADEEEMELDIDVLGDDTLFELQ
QLLDDYDRVNPSRNLTKEDPHEAESRSQYELINPSVCNDGNELIDEDVDIGENDPPILAL
PPVVLEDETADRNSKHSTSSSSSSDSESSSSDSDSSSSSGSDADAKAPQQNSGSKEKVLP
VDGVDQEKDSLSTLNLPEQSTNPISVSADGEGGNVSEKQVSPDKQIRAALLRSRFADTIL
KAREKALDQTTKKDPEKLRREREELERVQREERARLQAEAKAAEDVRKRAEAAAAAEAAA
EAKRQRELEREAARKALQEMEKTVDINEGSHFLKDLEMLGSVTGEQIPNLVGETSPGFQM
GSNTLEKLGLYMKNDEDDEDGDFTDEPVADVEEGEID*

MMGKTHMFSKGHPLGFVPDYRHRVEAMGEFKRLGSPVRVDSGSYCPPPKRKCVSVNSEER
ECASGFSLTRVPREVFSLPSMTALDKKDVEMRLHHELAQVKDLQIRLFSGGHNVGSMNGA
TVASAPGSDMLPKKKAEKLRRSNSVQTDRGAPPPMATAVAPPVSSSINYTSSFKQCANLL
KSLMSHVWASPFLVPVDIVKLNIPDYFQIVKQPMDLGTIQKRMKAGMYSTPPEFAADVRL
TFSNAMNYNPANNDVHLMAKTLSKNFESRWKLIEKKLPKPDEKPPQPDEKPPQPVEKPPV
RKPTKKNSTKRVSIEKEDLTKKKPSKKSVPKQYIFRGEDSADSPVLQPKKRKTSPLVQDA
PLVGDIVPTRKRIMTSEQKYDLSARLQSYGAFIPDHVVELIRSHADYCDANEEELELDMD
ALGDDTLFELLRLLDDYDRVNPSRNLTEQDPHEVKSRSQYELINASVCNEEVNELFDEDV
DIGENDPPVLTFPPLVLEDETADRSRKHSASSSSSSDSESSSSGSGSSSSSGSDTDAKAA
QQNSVSKEKILPVDGLGHEKDSLDTLNLPEQSTDPVSVSAYGEGGYVSEKVSPEKQIRAA
LLRSRFADTILKAREKALDQTTKKDPEKLRREREELERLQRQERARLQAEAKAAEDACKR
AEEAAAAEAAAEAKRQRDIEREAARKALQEMERTVDINGGSHFLKDLEMLRGITCEEMPN
LVGEGSPGFQLGSSNALAKLGLYMKDDEDDEEGDLADAPVVVDIEEGEID*

Other information
Ka divergence:0.2899KaKs divergence:0.255471
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2274Length 2 (bp):2313Length divergence:0.009
MFE 1 (kcal):-758.54MFE 2 (kcal):-748.44MFE divergence-0.007