Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G127309-GRMZM2G100524
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193588
Function (paralog2):hypothetical protein LOC100274879

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASACPLTLRFLFSCILLQTICCSGVSVELSYDSAQVKALSSSAVTEYRVTVTDKRRAYY
VFQKPFVCRDKPCRSSEPIAAAGSFVNEAIAGAKRHEPEANGELAVVAEIEGAGVVPHVK
SRVAPSAVAMSSGREKRLLGVLVDVPSPRRELGEARATARDEFSPVSNPATTPVSNPVTV
PATNPMPPGFVTVPSTNPGNGIATNPNLPPLYPEPTTPGTMPMPDPTTTPVTVPPAFTNP
VAAPNTMPGTAVTNPATTPTQFPGSSPVTNPVTTYPYPQQGGMPATTPPAVYQPPATAMP
GTVQPGAPTVAGQAAWCVAKSGLMDTALQDGIDYACGVGGADCSAIQPMGACYNPNTLQA
HASYAFNSYFQRNPSAASCDFGGAGMLVNVNPSSGTCVYQTPAGFGAGYSPGTTGVGVPS
GYTPGMSGAVGGGSGSTVLNANDPGGNSMYDDGYDNPTGLTAGSASLSCGGRVVVCLIWM
VTFAFVREKML*

MAAASCPVALAFFSSSCILLLLQTICCSGVFVELSYDSTQVKVQVLSTSVVTDGYRVMVT
DKQRAYLFLKPFACRDKPCGSESTAGSFISDVLGPDRRLNVSGIVVTATGTRQLGALLRT
LRSLQASLGDAGLAERVKVSPELSMSSLRVVGKDLARATKKRRWGKVLEFVRRTRSLVFV
RVDTEAGANGEVVAVIEEAAAQVAAVLGADVGVVLHIKSRAVPSAAAMEKLTGRGEKRSL
GVLVDVSFPRRDRELGEARATAHDEFSPVSNPATTPVSNPVTVPATNPVANPMSPGFVTV
PSTNPGNGFASNTNLPPLYPEPTTAPVTMPTPDPTTTMPPPVTVPSPFANPVAAPTTTMP
GTVTNPATTPSQFPPVTNPVTTYPYPQQGGMPGTTPEVYQPPATTTPGTAQQSAPSVTGQ
GQAWCVAKSGLMDAALQDGIDYACGAGGADCSAIQPMGTCYNPNTLQAHASYAFNSYFQR
NPSATSCDFGGAGMLVNVNPSSGTCVYQTSAGFGAGYSPGTTTGGGGVPSGYTPGMPGAG
YGAAGGGVSGTMGGGSGSTVLNANNPGGNSMYGGYDNTAGLTAGSAPLPCGGGGWAVLCL
VWMVTFAFVKEKV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):1476Length 2 (bp):1842Length divergence:0.11
MFE 1 (kcal):-685.23MFE 2 (kcal):-885.13MFE divergence0.127