Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G127453-GRMZM2G132978
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277346
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.71325977940546
Log2 mRNA fold difference:-0.41618588977052
Log2 TE fold difference:1.1249834206258
Sequences
Protein sequence

MASLTTTTSSPAALPAATTAPAASSISPHAGSKRPLLAGDDAPWRATAATSAGQGIRPVP
RINHASVLRVSTQEDSAAYALAIMKHPDPIGEGLAMEAFAEAAGPECIVPGQQAPLRLMG
LKVWPVDIDMKFLEPFGRELHSMKKFMDKSCSVMDSSMANK*

MASLTTTTSSPAALPAATTATAASSISPHAGSKRPLLAGDDAPWRATAATAAGQGIRPVP
RIHHAPVLSVATQEDYAAYALDIMKHPNPIGEGLAMEAFAEAAGPECIVPGQQAPLRLMG
LKVWPLDIDMKFLEPFGRELHSMKKFMDKSCSVMDSSMANK*

Other information
Ka divergence:0.131256KaKs divergence:0.338991
GC content 1 (%):63GC content 2 (%):63GC content divergence:0
Length 1 (bp):486Length 2 (bp):486Length divergence:0
MFE 1 (kcal):-206.97MFE 2 (kcal):-192.5MFE divergence-0.036