Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G127780-GRMZM2G169116
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100193454

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1746200873403
Log2 mRNA fold difference:-0.38848517474042
Log2 TE fold difference:-0.71165376476866
Sequences
Protein sequence

MPNWRLVYLALQRWTEQARLPAAPGRPSFAVELEDTRSNAGFFCGELWCGLMEPKGELAQ
KRILPSRFAHPYAIEEAINSLEIDASTKASNVNLPAKKDASSSDAVSCISSGDAASTAKE
SEMNRETSFGDQGMYYYGYYYPGSYGGWDENGYFVGYNGVEVHPAVVQTDNGSYLCHLPG
YENGYASYSQVVPGGIASVDGQYVSKEPYYSTALPIQDPRTPGIFAQPIAYRTELASAYS
WDPSFVLLDGVQGHPVGVHQTNYAARPKYSFNKHVIPSSKATRSAKSAADTVKGSSSALE
TVTNAVNSSPPSKSANKTPGASITKGYLPYSKSVMHTNNQEKNSVYQSKGINVKESGRSW
NSREKLGRSKLNGQGDSESNENNHTDNLKHSLSHRSDVVGLSSAGDANASIPSPVAISKN
ACNLSDFVTKYEQALFFVIKSYSEDDIHKSVKYNVWASTPNGNKRLDNAYRVAQERIAEK
GTKCPVFLFFSVNASGQFCGVAEMVGPVDFNRNMNFWQQDKWNGFFSVKWHIIKDVPNPQ
FRHIILENNENKPVTNSRDTQEVNFSQGTEMLNIFKNFTCKTSILDDFDFYENRQKVMQD
RRGKLLTTSFDHPLPKAEKSPEIKSQTQLISGPEVGRAKSDEGQGNNVGMVLDTTKKNEE
QSSNVPEILDAACSNKEQPNKIAIEG*

MEPKGESGQKPIEEAIDSLKTDASMKANNVNLPAKKDASSSDAVSCISSGDAASTVKDRE
MNQETSFGDQGMHYYGYYYPGAYGGWDENGYFVGYNGLEVHPAVVQADNGSYLCYPLGYE
NGYASYIPVVPGGIASVDGQYVSKEPYYSSALPIQDPSTPGIFAQPIAYGTELVPAYSWD
PFVLLDGVQGHPVGVHHTNYAPRPKYSSNKHVVPSLKASHSAKSTADTVKGSSSALETVP
NAANSSTSSKGANKAPGASITKGYLPSSKFVMHSNNQAKSSVYQSKGINLKESGRSWHSS
EKLKARSKLNGHGDSESNENNHTDNSKYSLSSQSDVVGLSSVGDANASIPSPVVIRKTAY
NLSDFVTKYEQALFFVIKSYSEDDIHKSIKYNVWASTPNGNKRLDNAYRLAQERMAEKGT
KCPVFLFFSVNASGQFCGVAEMVGPVDFNRNMNFWQQDKWNGFFSVKWHIIKDVPNPQFR
HIILENNENKPVTNSRDTQEVKFSQGTEMLNIFKNFTCKASILDDFDFYENRQKVMQDRR
GKPLTSFGHPLPKAEKTAEVKRQTQLISATEVGRADTTKENEEKSSSVPEILNAACSNKE
KPNKIATDG*

Other information
Ka divergence:0.0162054KaKs divergence:0.00419801
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):2061Length 2 (bp):1830Length divergence:-0.059
MFE 1 (kcal):-628.73MFE 2 (kcal):-538.56MFE divergence-0.077