Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128160-GRMZM2G142443
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275680
Function (paralog2):hypothetical protein LOC100275560

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.58499556255828
Log2 mRNA fold difference:-0.017254549821641
Log2 TE fold difference:-0.56606366913026
Sequences
Protein sequence

MVQLPSSGKRHAEPAMAPARRAATVKLEVEELGADERCPLSKRAKAALPMPPTPPQPQQD
MYHNVLDEPSPLGLRLKKSPSLLDLIQMRLSQASNAGESSMDNSGSEPSKKKDNKSGASA
AGERLKASNFPASILKIGSWEYVSRYEGDLVAKCYFAKHKLVWEVLEGGLKSKIEIQWSD
ITALKATCPENGQGTLDVALARPPLFFKETDPQPRKHTLWQATSDFTGGQASVHRRHFLQ
CPSTLLSKNFEKLIQCDQRLYQLSQQPEITLDSALFEPRSSIFEDPVESKCAGFTNLKDE
HEALPGYSGPVSPCAGSSISAKNENNDSIGMTAEYLSQTVGTGVGAVGVQAVGRNVNGAA
PEFTIPHWWSQLKVPGLRPSMSVDDFVNHLGNCISEQITSGNPALANNEVPTKETLEGIA
QYLLGDTQGPPVSASDERSLMARVDSLCCLIQKDTVPVTKPKPEPNDSDSIGVEASDGSD
EEFSSAPTGKPTDATNLPAMSRKDSFGELLTNLPRIASLPQFLFKIPEGTEN*

MVQLPSSGKRHAEPAEQTMAPARRAAAVKLEVEELGANERGPLSKRARPAQPMPPTPPQP
QQDMYHNVLDEPSPLGLRLKKSPSLLDLIQMRLSQASNAGESSMDNSGSEPSKKKDSKSG
VSSAGERLKASNFPANILKIGSWEYVSRYEGDLVAKCYFAKHKLVWEVLEGGLKSKIEIQ
WSDIAALKAICPENGQGTLDVVLARPPLFFKETDPQPRKHTLWQAASDFTGGQASMHRRH
FLQCPSTLLSKNFEKLIQCDQRLYQLSQQPEITLDPTLFEPRCTIFEDPVESKCAGFTNL
KDEHRALPGYSDSVSPCAGSSISAKKENNDSIRMPAEYPPQTVGIGIFTGVGAVGAQAVS
RNVNGAAPEFNIPNWWSQLKVPGLRPSMSVDDLVNHLGNCISEQITSGDPALANNEVPTK
ETLEGIAQYLLGDTQGPPVTAAVERSLMARVDSLCCLIQKDTAPVAKPKPEPNDGDSIGV
EASDGSDEEFTSAPTGKPTDATNPPAMSRKDSFGELLTNLPRIASLPQFLFKIPEGTEN*

Other information
Ka divergence:0.273103KaKs divergence:0.484033
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):1599Length 2 (bp):1620Length divergence:0.007
MFE 1 (kcal):-558.7MFE 2 (kcal):-568.52MFE divergence0.009