Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128212-GRMZM2G703281
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.327413220847
Log2 mRNA fold difference:-1.0713774124139
Log2 TE fold difference:0.30668657128448
Sequences
Protein sequence

MSEQDGQHVGGSPPDAAIESFSQLPFVRPKPPQPASSSSPSSIRLFGFEVPPDAATSSTA
TSDATAASATVAGQAAASGAAGAGAGASDGTGGGRKFECHYCCRNFPTSQALGGHQNAHK
RERQHAKRAQYQSAMAMHHAHYPGHPHAYPAFTSYHQQQRFGMARYEPPPPGPPPHYPSW
SPQAAPPVVPRYYGRACSLSQPINGSPIPAAALWRVPAVTAAAPLVRQERPTPLSLGGRD
EEEAMTGARRGNVVAARQVGSRSSSSSSTASQHERRRAGAAENRENVSLDLTL*

MSEQDGQHVAASTPDTAIESFSQLPFVRPKPPQPASTSSASSIRLFGFKVPPDAAATSSS
TGTSDATAASATVAGQAAVSGAGAGDGGGGGRKFECHYCRRNFPTSQALGGHQNAHKRER
QHAKRAQCQSAMAMHHAHHYPDHTHAYPAFTSYHHQFGMARYEPPPHYPSWSSHLPHAAP
PLVPRYYGGSGSLSQPINGSPVPAAALWRVPAAVSVAAPLVRQERPTPLSLCGHDEEALT
GARRGDISADAGQGGSRSSSTSSSTSSRHQPRRAGAAENRENRLFMRTVARAEALLST*

Other information
Ka divergence:0.164639KaKs divergence:-0.0657286
GC content 1 (%):69GC content 2 (%):68GC content divergence:-0.007
Length 1 (bp):882Length 2 (bp):897Length divergence:0.008
MFE 1 (kcal):-421.3MFE 2 (kcal):-409.7MFE divergence-0.014