Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128515-GRMZM2G127080
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100382294

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRGPASVKAGSRPPWLGLGAAAWVQVAGGASSTFALYSHALKVALGADQSRLALLGVACD
VGENLGLLPGVLCNRLHPALLLLIGAGACLLGYGTAWLLVSGVAPALPYWLIWFALCLAT
NGGAWLATAVLVTNMRNFPLSRGAVAGILKGYSGLSAAVYTEIYTGVLRDSPINLLLSLA
LGIPAVCLLGMYFVQPCEPSLVETNAEQVHFMFAQVASVLLGVYLVGATILDHVVAVNDI
MNYSLLVVMVLLIFAPLAIPLKMTLFPKKKNPLDSHSPTVDNDHTQPLLPSSSESNLGNL
EEDDSTDIDVLLAEGEGAIKPKRRRPRRGEDFRFREAILKADFWLLFAICFVGIGSGITV
LNNLAQIGIAAGAVDTTISLSVFSFCNFFGRLGGGAVSEYLVRSRTLPRSVLVICTQVVM
IITYLLFALGRLATLYVSVALLGLCYGVLLSVVISTSSELFGLKHFGKIYNFITLANPVG
AYLFNTLAGYVYDLEVERQHAAAAAAGSDVVACHGPSCFRLTFCVLAGAACLGTLLSTVL
TVRVRPVYQMLYAGGSFSQPRNSAH*

MRGPASVKAGSRPPWLGLGAAAWVQVAGGAGSTFALYSHALKVALGADQSRLALLGVACD
VGENLGLLPGVLCNRLHPALLLIIGAGACLLGYGTAWLLVSGVAPALPYWLIWFGLCLAT
NGGAWLATAVLVTNMRNFPVSRGAVAGILKGYSGLSAAVYTEIYTGVLRDSPINLLLFLT
LGIPAVCLLAMYFVQPCEPSLVETNAEQVHFMFAQVASVFLGVYLVGATILDHIVTLNDI
MNYSLLVIMVLLIFAPLAIPLKMTLFLKKKSRSDSHSPTTDNGHTEPLLPSSSESNLGNL
EDDTTDIDILLAEGEGAIKPKRRRPRRGEDFRFREAILKADFWLLFAICFVGFGSGITVL
NNLAQIGIAAGAVDTTISLSVFSFCNFFGRLGGGVVSEYLVRSRTLPRSVLIIGTQAVMI
ITYLLFALGRLATLYVSVALLGICFGISLSVIISTSSELFGLKHFGKIFNFIALANPVGA
FLFNTLAGYVYDLEVEKQHATTSGSDVACHGPNCFRLTFCVLSGVACLGTLLSTVLTVRV
RPVYQMLYAGGSFSQPRNPAH*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):58GC content 2 (%):53GC content divergence:-0.045
Length 1 (bp):1698Length 2 (bp):1686Length divergence:-0.004
MFE 1 (kcal):-693.5MFE 2 (kcal):-609.16MFE divergence-0.065