Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128579-GRMZM2G158091
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381782
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.07729298008775
Log2 mRNA fold difference:-0.7627321125048
Log2 TE fold difference:0.83959847513849
Sequences
Protein sequence

MGKAKGKQRQDKFYHLAKEQGYRSRAAFKLLQLDARFHFLPTARSVLDLCAAPGGWVQVA
VNHAPVGAFVVGVDLVPIRPIRGAHSLTEDITATKCRAAVRRLMDSNGVSAFDVVLHDGS
PNVGGAWAQEATSQSALVIDALRLATMFLAPKGAFITKVFRSQDYNAIMYCLKQLFEKVE
ATKPTASRSTSAEIYIICLKYKAPAKIQPELLDIKHLFSVVPEQTKSRDVLDGRKKRHRD
GYEEGNTTLRKVGLASDFIWSDTQAPLEFLGSYNAISFDNPESLPIKNHELTTDDIKNFC
EDLLLLDKHSFKHILKWRIRLRKSLSASSQVTPKVNDAVESTKVMDDDVLLQEMEELTSV
IDRKKKREKKRLSKRRAKDKARKATGMQVDATGDDYGDPDLFSISVIKGGKELEAVESAE
IDVEDEIGDGDNEDTQALEDSDEEMDSDDEQQRYDAQLEEMLDEAYERFVTKKGGEIKQE
RKRAKRINPDADAELLEGGEDDGDVEMDQDFDEDQDQEANPLLFALDEQKPTKEQIVKQW
YSQDVFTEAATGVTERSDTEDEREILQRNKKMDTGKREKVAKAQDLQHDGFEIVPAEPVQ
NEEDSSSSSDESEDDIDDYRKAEVLAYAKKMLRKKQREQILDDAYNKHMFDDEGLPNWFV
EDEKRHRQPMKPVSREEVAAMRAQFKEIDARPSKKVAEAKARKKRVAMKKLDKARQKADA
IADQNDINELSKRKMIDRIYRKAMPKKPQKEYVVAKKGVQVRAGKGKVLVDPRMKKDKRA
SGTGKKGGKGAKGKGGQKGMRGKAGKKAGKAPR*

MGKAKGKQRQDKFYHLAKEQGYRSRAAFKLLQLDARFRFLLTAHSVLDLCAAPGGWVQVA
VNHAPVGAFVVGVDLVPIRPIRGAHSLTEDITTTKCRAAVRRLMDSNGVSAFDVVLHDGS
PNVGGAWAQEATSQSALVIDALRLATMFLAPKGAFITKVFRSQDYNAIMYCLKQLFEKVE
ATKPTASRSTSAEIYIICLKYKAPAKIQPELLDIKHLFSVVPEQTKSRDVMDGRKKRHRD
GYEEGNTTLRKVGLASDFIWSDAQAPLEFLGSYNAISFDNPESLPIKNHELTTDDIKNFC
EDLLLLDKNSFKHILKWRIRLRKALSVSSQVTLKANDAVENTKVMDDDVLLQEMEELTSV
IDRKKKREKKRLSKRRAKDKARKATGMQIDATGDDYGDPDLFSISVIKGGKELEAVESAE
VDVQNEIGDSENEDTQAREHSDEEMDSDEEQQRYDAQLEEMLDEAYERFVTRKGGEIKQE
RKRAKRINPDADADLLEGGEDDGVAEMDQDFDEDQDLDEHQDQETNPLLLALDEQRPTKE
QIVKQMSDTEDERESLQRNMKKMVTGKTEKVAKAQRLQRDDIEIVPAEPVRDEEDTSSSS
GESDVSEDELDDYRKAEVLAYAKKMLRKKQREQILDDAYNKYMFDDEGLPNWFVEDEKRH
RQPMKPVTREEVAAMRAQFKEIDARPSKKVAEAKARKKRVAMKKLDKARQKADAIADQND
INELSKRKMIDRIYRKAMPTKPQKEYVVAKKGVQLRTGKGKVLVDPRMKKDKRASGTCKK
GKKGGKGGKGKGGQKGMRGKTGKKAGKAPS*

Other information
Ka divergence:0.0329872KaKs divergence:0.35704
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2442Length 2 (bp):2433Length divergence:-0.002
MFE 1 (kcal):-804.1MFE 2 (kcal):-782.8MFE divergence-0.013