Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128613-GRMZM2G063369
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381815
Function (paralog2):hypothetical protein LOC100216573

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAADALSIIPGAVLRNLSDKLYEKRKNAALEIEGIVKQLAMAGEHERISAVISLLTNDFT
YSPQTNHRKGGLIGLAAVTVGLTSEAAQHLEQIVPPVLNSFLDQDSRVRYYACEALYNIA
KVVRGDFIIYFNKIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLR
ERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADAALS
EFLQEIKNSPINEFVKLGGEQLVPYYADILGAILPCISDEEEKIRVVARETNEELRAIKA
DPTEGFDIGAILSIAKRELNSEHEATRTEALHWFFTLLDQYRAEFLAYLNDIFDPLLNAL
SDPSDVVVLLVLEVHARIAEESHHFHHLVSYLICTFHNNHFLLEKRGALIVRRLCVLLGA
EKVYREFSTILESEVDLDFASVMVQALNLILLTSTELGELRSLLKKSLVDSCGKDLFQSL
YASWRHSPMATISLCLLAQAYSHASCVIQSLGEEDINVKFLVQLDKLIRLLETPVFAYLR
LQLLEPGKHTWLLKTLYGLLMLLPQQSAAFKILRTRLKTVPFSENIKRTSSANPYSQILQ
VTEDGNRNQDTQNYSAINFPSLLQQFEHMQLQHRNHLKDQLQSRKSASALTLSQEIQRYE
AAHSSSLSEINRPPSRTSKGIL*

MAADALSIIPGAVLRNLSDKLYEKRKNAALEIEGIVKQLATFGEHEKISAVISLLTNDFT
YSPQANHRKGGLIGLAAVTVGLTSEAAQHLEQIVPPVLTSFLDQDSRVRYYACEALYNIA
KVVRGDFIIYFNKIFDALCKLSADSDANVQSAAHLLDKLVKDIVTESDQFSIEEFIPLLR
ERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADAALS
EFLQEIKNSPNVDYGRMAEILVRRAGSTDEFTRLTSITWINEFVKLGGEQLVPYYADILG
AVLPCISDEEEKIRVVARETNEELRAIKADPAEGFDIGAILSIAKRELNSEHEATRIEAL
HWFFTLLDRYCAEFLAYLNDIFDPLLNALSDPSDAVVLLVLEVHARIAEESHHFHHLVSY
LIRTFHNNHFVLEKRGALIVRRLCVLLGAEKVYREFSTILESEVDLDFASVMVQVLNLIL
LTSTELGELRSPLKKSLVDSCGKDLFQSLYASWRHSPMATISLCLLAQAYNHASCVIQSL
GEEDINVNFLVQLDKLIRLLETPVFAYLRLQLLEPGKHTWLLKTLYGLLMLLPQQSAAFK
ILRTRLKTVPFSENLKRTSSANPYSQILQVTEDGNRNQDMQNYSAINFPFLLQQFENMQL
QHRNHLKDQLQSRKSASTLTLSQEIQRYEEAHSSSLSEINRPPSRTSKGIL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2049Length 2 (bp):2136Length divergence:0.021
MFE 1 (kcal):-625.42MFE 2 (kcal):-642.03MFE divergence0.013