Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128663-GRMZM5G854045
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281422
Function (paralog2):hypothetical protein LOC100279309

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.2182377074243
Log2 mRNA fold difference:1.6811492970911
Log2 TE fold difference:-3.9080482357072
Sequences
Protein sequence

MEGRGNPPHTTTDAVIKKPRSVASRKPRSTEQLTYEYNGICPPSWSAPHDDDTGVGAGGH
RRKELHLNSPEMKGSMAHRSDVPRKIRRDDRSGGDHDGHGRSSKAKDAAKHGSENVLALE
CTARNNGSPDNPQLVPRDDSMPCENRSRKVKLKVVSRTLHAKNGQDAGGSGIPATLDGSI
HQYKQKDSGGHTNKETHGNRVEGKHGNGHEIFPSSDLVRKSKRIPKKKTLDGDSDDEDGE
LRYLEKLKGAKVAPDPVNTSHKGYDFGDDALKKKKLSKLSRNKSTPYEVDDDFRMSRSGR
DGRKKLNLGDDNEFIEEEESEMDETNGLKEPDSPQGVKIETPGLTTRQRALQGRGGNGES
FIEFPDGLPAASSRKQKEKLSDMEIQAKKAEAALRRKMQVEKAEKEQQAEAMRKILGIDS
EKKKEEKKLKEREEREKQARLEEYRKNCVQTVMGPTGTVITFPESMGLPSIFNSKPVSYP
PPREKCAGPSCTNPYKYRHSKTLVPLCSLACYKAVEDRPPAQGSEGGGGQGSDAGQGTDA
AQESAGKQA*

MEGLNATDAVIKKPRSVAFRKPRSMKQLTVECNGICLPSRSARHDDDTGVEAGGQRRKEL
HLNSPEMKGSMTHRSDVPSKIRRDDKSGGDYDGHGRSRKTKDAAKHGSESVLALECTARN
IESLDNPQLVPRDDSLPGENRPRKVKFKFNRTQRTKNGQDDGGSGIPATSACFINQYKQK
DSGGHTTKDTHGNRAEGKHGNKHGNSLSPDLVCKSKRIPKKRTLDEDSDDGDGEIRYLQK
LKGAKVAPDPVNTGHKAYDFVDDALKKKELTKLSKNKSIPYEVDEDFRMSRSGRNGRKKL
GDDNEFIEDEESEMEEKSGLKKADSPQDVKIETPGLTTRQRALQSRGGNGESFIEFPDGL
PAASSRKQKEKLSDVELQAKKAEAAQRRKMQVEKAEKEQQAEAMRKILGLDSEKKKEEKK
LKERENREKQAKLEECKKNCVRTVMGPTGTVITFPESMGLPSIFNSKPVSYPPPREKCAG
PSCTNPYKYRDSKTLLPLCSLACYKAVQGRPPDQGTDAAQGSGGGQESAGKQA*

Other information
Ka divergence:0.373542KaKs divergence:0.398058
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1650Length 2 (bp):1602Length divergence:-0.015
MFE 1 (kcal):-539.97MFE 2 (kcal):-506MFE divergence-0.032