Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128877-GRMZM2G421857
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):V-type proton ATPase catalytic subunit A Fragment (V-ATPase subunit A)(EC 3.6.3.14)(Vacuolar proton pump subunit alpha)(V-ATPase 69 kDa subunit)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.97117507721029
Log2 mRNA fold difference:1.3062552204033
Log2 TE fold difference:-0.32844718908874
Sequences
Protein sequence

MAYGDRVTTFEDSEKESEYGYVRKVSGPVVVADGMGGAAMYELVRVGHDNLIGEIIRLEG
DSATIQVYEETAGLMVNDPVLRTRKPLSVELGPGILGNIFDGIQRPLKTIAIKSGDVYIP
RGVSVPALDKDALWEFQPKKLGSVGDVITGGDLYATVFENTLMQHHVALPPGSMGKISYI
APAGQYNLQDTVLELEFQGIKKNFTMLQTWPVRSPRPVASKLAADTPLLTGQRVLDALFP
SVLGGTCAIPGAFGCGKTVISQALSKYSNSEAVVYVGCGERGNEMAEVLMDFPQLTMTLP
DGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEAL
REISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGSPDRTGSVTIVGAVSPPGGDFS
DPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSKALESFYEKFDPDFIDIRTK
AREVLQREDDLNEIVQLVGKDALAESDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSV
WMMRNIIHFNTLANQAVERAAGTDGQKITYGVIKHRLGDLFYRLVSQKFEDPAEGEEALV
GKFKKLYDDLTTGFRNLEDEAR*

MAYGDRVTTFEDSEKESEYGYVRKIWLPAGSRLGIWVVLAVTVVDLLGVAGLVQVVLACW
DLASIGGQVSGPVVVADGMGGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMV
NDPVLRTRKPLSVELGPGILGNIFDGIQRPLKTIAIKSGDVYIPRGVSVPALDKDVLWEF
QPTKLGVGDVITGGDLYATVFENTLMQHHVALPPGSMGKISYIAPAGQYNLQDTVLELEF
QGIKKKFTMLQTWPVRSPRPVASKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGK
TVISQALSKYSNSEAVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANT
SNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYP
AYLAARLASFYERAGKVKCLGSPDRNGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGL
DKKLAQRKHFPSVNWLISYSKYSKALESFYEKFDPDFIDIRTKAREVLQREDDLNEIVQL
VGKDALAESDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMRNIIHFNTLANQAV
ERAAGTDGHKITYSVIKHRLGDLFYRLVSQKFEDPAEGEEALVGKFKKLYDDLTTGFRNL
EDEARPRCARLSAEAVAGRRYVPSPPRDPDAPGRLLRLRAGCIVPRIALVKSGKAEVDPT
VEPRRCAGLNFVLEQNTLKSIEIELTEEMAPNLLQTDMVMQFGLLVFQVLNFGDQGKIQE
AMVQMHIREEETVICIYGQNLDFVLVEVSLNNMVPETSTNYDLLNHILNELRVPLIAATR
ERIMHLMTVKI*

Other information
Ka divergence:-0.215339KaKs divergence:0.199301
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1869Length 2 (bp):2556Length divergence:0.155
MFE 1 (kcal):-613.97MFE 2 (kcal):-883.88MFE divergence0.18