Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128880-GRMZM2G138624
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192753
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.9160852871695
Log2 mRNA fold difference:1.4570508587757
Log2 TE fold difference:0.40960408222862
Sequences
Protein sequence

MGTEADAAAVDSLRSQIPFQTDGELILPPRDVGLVLVDLCNGFCTVGAGNLAPVAPNKQI
SKMVEEAARLSKLFCDRNLPIFAFLDTHYPDKPEPPYPPHCIIGTGEENFVPDLEWLEKE
PNVTIKRKSCIDGYISCIEEDGSSVFVDWVGKYQIKTVLVLGICTDICVLDFASSTLAAR
NIDRVPPLRDVVIYSEGCATYDLPVEIAMNIKGALAHPQDLMHHIGLYMAKGRGAKVVDR
VVIEP*

MHDKRRMGTEADAAAVDLLRSQIPFQTDGEFVLPPRGVGLVLVDLCNGFCTVGAGNLAPV
APNKQISKMVEEAARLSKLFCDRNLPIFAFLDTHYPDKPEPPYPPHCIIGTGEEDFVPDL
EWLEKEPNVTIKRKSCIDGYISCIEKDGSSVFADWIGKYQIKTVSCLDTEDFRDRLYPIV
YDLGGIGSMQVLVLGICTDICVLDFASSTLAARNIDRVPPLQDVVIYSGGCATYDLPVEI
ATNIKGALAHPQVPDH*

Other information
Ka divergence:-0.13367KaKs divergence:0.139668
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):738Length 2 (bp):771Length divergence:0.022
MFE 1 (kcal):-258.5MFE 2 (kcal):-274.94MFE divergence0.031