Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128902-GRMZM2G138632
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275076
Function (paralog2):hypothetical protein LOC100193981

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.88777036646889
Log2 mRNA fold difference:-0.74535241939358
Log2 TE fold difference:-0.19627063786686
Sequences
Protein sequence

MALSTPASILVDENQQINRGKRADGPRAKGLKPSENPGNQGRRALKDLSNFSKGTGLKDT
STLKEKSQQKPRSNVANTIKGNALKDKPILKEKSTQEQRSKALKNPMKILVDEEIKMCHE
WAKDGVEGFHSTQNNSQKLDKDLLDKRVKKKVAAVNSALCGWPDTVFDSLMYPSMEVAEL
FYEQNVLEVEPEILPDISWRLSSSVDGKAKIDEDRLTDAELDQYHSLENNPIIFELRDEP
AIPQLGVY*

MAFPTPASVFVDENQQINRGKRAAGSRTKGLKPSENPGNLERRALQDLSNFAKGTGLKGT
STLKERSQRKAFSNVTNTIKGTALKDRPITKEKSTQKQRSQNPVKILSDEDIKLCHEWAK
DGVEGFHSTQNDSQKVDKDLLAKRVKKKVASVNSALRGWSDTVFDSLMFPAREVLYEPKV
LELEPEILRDISWDLPSSVDGKAKLDEDCLAYDQLDQYPSLENNPVTFELRDEPAIPQLG
VH*

Other information
Ka divergence:-0.0906808KaKs divergence:0.172712
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):747Length 2 (bp):729Length divergence:-0.012
MFE 1 (kcal):-228.76MFE 2 (kcal):-252.4MFE divergence0.049