Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G128929-GRMZM2G173192
Species:maize
Duplication type:TD
Function (paralog1):L-lactate dehydrogenase (LDH)(EC 1.1.1.27)
Function (paralog2):hypothetical protein LOC100193279

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.42867817106752
Log2 mRNA fold difference:-3.8583068150719
Log2 TE fold difference:3.3890410113694
Sequences
Protein sequence

MKKATSLSELGFDAGDASSGFFRPVSGDSSTPTSQHHRRRLTKVSVIGAGNVGMAIAQTI
LTRDLADEIALVDAVPDKLRGEMLDLQHAAAFLPRTRLVSGTDMSVTRGSDLVIVTAGAR
QIQGETRLDLLQRNVALFRKIVPPLAEQSHDALLLVVSNPVDVLTYVAWKLSGFPASRVI
GSGTNLDSSRFRFLLAEHLDVNAQDVQAYMVGEHGDSSVAVWSSVSVAGMPVLKSLQESH
RCFDEEALEGIRRAVVDSAYEVISLKGYTSWAIGYSVASLAASLLRDQRRIHPVSVLARG
FHGIPDGNDVFLSLPARLGRAGVQGVAEMELTEEEAKRLRRSAKTIWENCQLLGL*

MMKKASSLSELGFDANGASSGFFRPVTDGGVTPTSPHHRRRLTKVSVIGAGNVGMAIAQT
ILTRDLADEIALVDALPDKLRGEMLDLQHAAAFLPRTRLVSGTDMSVTRGSDLAIVTAGA
RQIPGETRLDLLQRNVALFRKIVPPLAEQSPDALLLVVSNPVDVLTHVAWKLSGFPATRV
IGSGTNLDSSRFRFLLAEHLGANAQDVQAYMVGEHGDSSVAVWSTVSVAGMPVLKTLRDS
HSSFGEEALEGIRRAVVDSAYEVIGLKGYTSWAIGYSVANLVSSLLRDQRRIHPVSVLAA
GFHGIPDDQEVFLSLPARLGRAGILGVADMELTEEEARRLRRSAKTLWENTQLLGL*

Other information
Ka divergence:0.347951KaKs divergence:-0.507769
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):1068Length 2 (bp):1071Length divergence:0.001
MFE 1 (kcal):-571.15MFE 2 (kcal):-535MFE divergence-0.033