Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G129007-GRMZM2G086116
Species:maize
Duplication type:WGD
Function (paralog1):ATP-dependent RNA helicase dhh1
Function (paralog2):hypothetical protein LOC100272835

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MHQPRARYPPGYGSSGGGGGGGGGSGGGRGGSGGGGNHNYYGRNTHPQHQHHYQQQQQHS
HRNSSHQQQWLRRDQGPAVAGPVSGNAVPKTAPQLDAVDSSSQDWKAQLNIPAPDTRYRT
EDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKT
AAFCIPALEKIDPENNAIQVVILVPTRELALQTSQVCKELGKYLNIEVMVSTGGTSLKDD
IMRLYQPVHLLVGTPGRILDLTRKGICVLKDCSMLVMDEADKLLAPEFQPSVEALIHFLP
PSRQLLMFSATFPVTVKEFKEKYLPRPYVINLMDELTLKGITQYYAFVEERQKVHCLNTL
FSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNL
VCTDLFTRGIDIQAVNVVINFDFPKTSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYR
IEQELGTEIKTIPPQIDLAVYCQ*

MHQPRARYPPGYGSGGGGGAGRGGGGGNGGGGGNHNYYGRNPQQHHYHQQQQSQHSHRNS
SYQQQWLRRDQAPAVAGAASGNAVAKTASQLDAVGSSSQDWKAQLNIPAPDTRYRTEDVT
ATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFC
IPALEKIDPEKNAIQVVILVPTRELALQTSQVCKELGKYLNIQVMVSTGGTSLKDDIMRL
YQPVHLLVGTPGRILDLTRKGICVLKDCSMLVMDEADKLLAPEFQPSVEALIHFLPPSRQ
LLMFSATFPVTVKEFKDKYLPRPYVINLMDELTLKGITQYYAFVEERQKVHCLNTLFSKL
QINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTD
LFTRGIDIQAVNVVINFDFPKTSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQE
LGTEIKTIPPQIDLSIYCQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1512Length 2 (bp):1500Length divergence:-0.004
MFE 1 (kcal):-465.43MFE 2 (kcal):-458.13MFE divergence-0.008