Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G129015-GRMZM5G899149
Species:maize
Duplication type:WGD
Function (paralog1):40S ribosomal protein S26
Function (paralog2):hypothetical protein LOC100193262

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.18182336666017
Log2 mRNA fold difference:0.26333527071515
Log2 TE fold difference:-0.082354076046776
Sequences
Protein sequence

MTFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVHD
GYVLPKLYAKVHHCVSCAIHAHIVRVRSRENRRNREPPQRFRRRDDGPRPGQGPPRPGAA
ATAAPPAAAPRA*

MTFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVHD
GYVLPKLYAKVHHCVSCAIHAHIVRVRSRENRRNREPPQRFRRRDDGPRPGQGPPRPGGA
APAAAAAAAPRT*

Other information
Ka divergence:-0.604669KaKs divergence:-0.766789
GC content 1 (%):59GC content 2 (%):59GC content divergence:0
Length 1 (bp):399Length 2 (bp):399Length divergence:0
MFE 1 (kcal):-163.71MFE 2 (kcal):-158.2MFE divergence-0.017