Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G129155-GRMZM2G180335
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383931
Function (paralog2):hypothetical protein LOC100279900 (LOC100279900), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.21104944405458
Log2 mRNA fold difference:0.75495865720007
Log2 TE fold difference:-0.96191982578167
Sequences
Protein sequence

MAEDHLSSAPSAPSAAAAAAAAAVGSSVIPIVNKLQDIFAQLGSSSTIDLPQVAVVGSQS
SGKSSVLEALVGRDFLPRGSDICTRRPLVLQLVHQPRRPADAEADEWGEFLHLSGRRFYD
FREIRREIQAETDREAGGNKGVSDRQIRLKIFSPNVLNITLVDLPGITKVPVGDQPTDIE
ARIRTMIMSYIRHKTCIILAVSPANADLANSDALQMARVADPDGSRTIGVITKLDIMDRG
TDARNFLLGNVIPLKLGYVGVVNRSQQDINSDLSIKDALAREEKFFRTQPAYHGIAQYCG
IPQLAKKLNQILVQHIKTVLPGLKSRISSQLTAVAKELAVYGDPVDSKAGQGAKLLNILA
KYCEAFSSMVEGKNEDISTIELSGGARIHYIFQSIFVKSLEEVDPCEDVTDEDIRMAIQN
ATGPRSALFVPEVPFEVLVRRQISRLLDPSLQCAQFIYDELVKMSHRCLAMELQQFPILR
RSMDEVIGKFLRDGLKPAENMIAHIIEMEEDYINTSHPNFIGGSKAVEQAQQQVRSAKMS
AAVVRKDGVDAQASEKTQKSRAILGRSGVNGVVTDHIQGVRPAAEAERPGSSGSGSTSFW
NQIFTSNEDRTHPPARDNTTNKSYAVPAPNLEHSFSTIQLREPPVVLKPSEHQSEQEALE
IAITKLLLKSYYNIVRKNVEDLIPKAVMHFLVNHTKRALHNYLITKLYRDDLLEDLLKEP
DEITIKRKQIRENLKVLQQAYKTLDEIPLDAEAVERGGYSLDSDAIGLPRAHGLSSSLHG
FNDGSSPYSTPKQSRSRRSNHSGEQLPFNPNMSGNGF*

MAEDHFSSAPSAPSAAATAAAAAAAAVGSSVIPIVNKLQDIFAQLGSSSTIDLPQVAVVG
SQSSGKSSVLEALVGRDFLPRGSDICTRRPLVLQLVHQPRRPADAEADEWGEFLHLSGRR
FYDFREIRREIQAETDREAGGNKGVSDRQIRLKIFSPNVLNITLVDLPGITKVPVGDQPT
DIEARIRTMIMSYIKHKTCIILAVSPANADLANSDALQMARVADPDGSRTIGVITKLDIM
DRGTDARNFLLGNVIPLKLGYVGVVNRSQQDINSDLSIKDALAREEKFFRTQPAYHGLAQ
YCGIPQLAKKLNQILVQHIKTVLPGLKSRISSQLTAVAKELAVYGDPVDSKAGQGAKLLN
ILAKYCEAFSSMVEGKNEDISTTELSGGARIHYIFQSIFVKSLEEVDPCEDVTDVDIRMA
IQNATGPRSALFVPEVPFEVLVRRQISRLLDPSLQCAQFIYDELVKMSHRCLATELQQFP
ILRRSMDEVIGKFLRDGLKPAESMISHIIEMEEDYINTSHPSFIGGSKAVEEAQQQVRSA
KTSAVVVRKDGVDSQVSEKTQKSRPILGRSGVNGVVTDHIQGVRPAAEAERPGSSGSGST
SFWNQIFTSNEDRTHAPARDNTANKSYAMPAPNLDHSFSTIQLREPPVVLKPSEHQSEQE
ALEIAITKLLLKSYYNIVRKNVEDFIPKAIMHFLVNHTKRALHNYLITKLYRDDLLEDLL
KEPDELTIKRKQIRENLKVLQQAYKTLDEIPLDAEAVERGGGYSLDSDAIGLPRAHGLSS
SLHGFNDGSSSYSTPKQSRSRRPNHSGEQLPFNPATSGNGF*

Other information
Ka divergence:0.400704KaKs divergence:0.208575
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2454Length 2 (bp):2466Length divergence:0.002
MFE 1 (kcal):-824.02MFE 2 (kcal):-831.66MFE divergence0.005