Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G129243-GRMZM2G172021
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100191448

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.38790933975277
Log2 mRNA fold difference:-0.022512933888563
Log2 TE fold difference:-0.34066223793759
Sequences
Protein sequence

MAPDPCADLAVTPKTSAKDEASCSVAPPTPPKVTPDEVRAVARKFADQPIQETEPDVWAV
LTAISKKARLRPQGMNILLSADEHYLGRAVEERFRVFAQQISGKHCKIYKDTVSGERNRH
EPVPVFFKDTSSNGTFINWKKFKKNASPVKLNHGDIISLPSPPHDGKSFVFVYREVNAIS
CVENGVPILKRKSEEGSSGSKRLKGLGIGSPDGPVSLDDVRRLEKSNADLREQLEAHVVT
IETLRAEIKTTQVQHGKELEELRETTSSSYLDQTKSLQSTLEEKQKQIDSLSTSNTELQN
SIKDLDERLGASKQSRADADEIISSQKAIIRELEEQLSEERNLRREERDKAAHDLKFAVH
KVQAEAQEEIKKQAESYLRQQREQKEVINKLQESEKETRLFVETLRSKLEDARDNLVTSE
KKVRELEAQFQDEQLVSANNRKKSENLETELRKLKKELENEKAAREEAWAKVSALELEIA
ATIRDLSIEKQRYQGARERIILRETQLRAFYSTTEEISSLFAKQQEQLKAMQRTLEDEEN
YESTLMSVDLNKEHLAIDNAGMKPVNCSKNTLGASIASPENTQVSEHSSSDEDANMTEQQ
DDDVTANGGNTQDLECTSPERSVERRPGFHGNPVPTAPEREVTDTEQVPETESEAGNVGC
DDQRCDNIGGETMPLEDEVLLPENEEPTALLKDAGQPQSNMVPIPILDDGGGHCSEEKHE
GACSESKRDDTHVGAIRTGDLLASEVAGSWAVETAPSVNGENESPRSLGDATERDEDGGS
VAADALLTLVNSEGQAAGSQNNVEQASSKITDDRRVLSAMIGIVDPEFRKQMSRSGAGNE
EPMSDAETDEGVEEGDSDSGSDGSDSDSEEAMVEDSVG*

MAPDPCGDLVVTPKTAAKDEASCSVPTPPKVTPDEVRAVARKFADQPIQETEPDVWAVLT
AISKKARLRPQGMNILLSADEHCLGRSVEERFRIFAQQISGMHCKIYRDTVLGELNRHEP
VPVFLKDTSSNGTFINWKRLKKNSSPVKLNHGDIISLSSPPHDDNSFVFVYREVNAISRV
ENGAPILKRKSVEGGSGSKRLKGLGIGSPDGPVSLDDVRRLEKSNADLREQLEAHVVTIE
TLRAEIKTAQVQHGKELEELRETISSSYLDQTKSLRSALEEKQKQIDSLSTSNTELQNSI
KDLDERLNASKQSRADADEIISSQKGMICELEGQLNEERNLRREERDKAAHDMKSALHKV
QAEAQEEIKKQAESYLRQQREQKEVISKLQESEKETRLFVETLRSKLEDARDNLVTSEKR
VRELEAQLQDEQMVSANNRKKTENLEAELRKLKKELDNEKAAREEAWAKVSALELEIAAT
IRDLSIEKQRYQGARERIILRETQLRAFYSTTEEISSLFAKQQEQLKAMQRTLEDEENYE
STLMGVDLNKVPLTTDNAGMKPVDCSKNTVGASSASPENTQVSEHDSSDEDANMTEQQDD
DGTAIGGSTQGLECTSPERSEGRLKSGFHGNPVSTAPEREVTDTEQVPETDSQAGNAGCD
DQRCDNTGGETMPLEDDMLLPDNEEPTALLKDVGQPQANVVPIPIPGDGVGHCFEEKHEG
ACSESKREDTHAGAIRTADLLASEVAGSWAVETAPSVNGENESPRSLGDATEHDEAGGSV
AGDALVTLVNSEGQAAGSQNNVERGSSKITHHHHHHRHHHRVLSAMIGIVDPEFRKQMSG
RSGVGNEEPMSDAETGEGIEEGDSDSGSDGSDSEEAMVEDSVV*

Other information
Ka divergence:-0.119287KaKs divergence:-0.214437
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2637Length 2 (bp):2652Length divergence:0.003
MFE 1 (kcal):-892MFE 2 (kcal):-911.6MFE divergence0.011