Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G129247-GRMZM2G132868
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279460
Function (paralog2):G-box-binding factor 4

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.55647661115609
Log2 mRNA fold difference:0.31893946222437
Log2 TE fold difference:0.16988148518987
Sequences
Protein sequence

MASSRVMASSSPPQHAGAGSSSDLARFRSSGGIGSMNMDNIMREIYGPEAVNATVNGRVE
PSPAAPEAAARRTSEEVWKEISAAGGLSAPVLPPPPAASTGAGARGGGGGASEMTLEDFL
ARDSCAMAAVMEGDMALGFPNCEGDAAGSVAGEAGGGRGSRKRALLDPADRAVMQRQKRM
IKNRESAARSRDRKQAYIAELESQVMQLEEYQAELLTEQEDRRQKRLKELVERVVPVIRK
KSPQDLRRNNSMEW*

MASSRVMASSSPPQHAGAGSSSDLARFKSSGVGSMNMDDIIRNIYGPEAVNAAAAESAGL
GPAEPSLAAPEAAARRTSEEVWKEISAAGGLPAPVLHIPPAASSGAGARGGGGAAEMTLE
DFLARDSCGRAAVMEGNMALGFPDGDGDAAGSVAGGVGGVRGGGKRALLDPADRAVMQRQ
KRMIKNRESAARSRDRKQAYVAELESQVMQLEEEQTELLREQEDRRQKRLKELTERAVPV
IRKKSPQDLRRTNSMEW*

Other information
Ka divergence:-0.271606KaKs divergence:-0.197312
GC content 1 (%):64GC content 2 (%):66GC content divergence:0.015
Length 1 (bp):765Length 2 (bp):774Length divergence:0.006
MFE 1 (kcal):-359.96MFE 2 (kcal):-382.9MFE divergence0.031