Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G129929-GRMZM2G325683
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100276676
Function (paralog2):hypothetical protein LOC100276188

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.60356742970574
Log2 mRNA fold difference:0.77709021656199
Log2 TE fold difference:0.71965442734605
Sequences
Protein sequence

MQVPTAVASTVHRPRAPQGGKQLITQAKAMAPRSRLLDLERHDVLSFYGGGAYHQSASAS
AWPPTATGSFSGPIDFLVAALLLHLVVPFPHAAAAVCGALYVAYCFLLDRSAQVSSWPSA
AAAMPSAEPSRPTTPGKVAAMQVAAGLRLP*

MAPRSRLLDLEKHDVLFFYGDGAYHQSERVSVVTRAIAFWPVFLVAALLLHLIAPFPHVA
AVCGALYVFLLDRAAQASCSSSWPSTATAAPPAEASRPTTRCTAAGYTVVQN*

Other information
Ka divergence:-0.241914KaKs divergence:0.363636
GC content 1 (%):65GC content 2 (%):68GC content divergence:0.023
Length 1 (bp):453Length 2 (bp):339Length divergence:-0.144
MFE 1 (kcal):-183.1MFE 2 (kcal):-141.6MFE divergence-0.128