Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G129973-GRMZM2G142922
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):LOC100284855

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.4648784944948
Log2 mRNA fold difference:1.5776198654401
Log2 TE fold difference:-0.1260395004732
Sequences
Protein sequence

MTSPSSHHPDSTSASSTPRAGVGNGGIHHLHPPSLHPAPAPTPAAPPAQAQAAHGGPQVR
LMCSFGGRILPRPGDRQLRYVGGETRIVSFPRAVTSFAALVAALAKVAPVLFAPGAPRPS
LKYQLPQDDLDSLVSITSDDDVDHLMDELDRIQDLSANVARPPRLRVFLFAPAPDAAFGS
VFSGTTSEAASTDQWFVDALNAPAPQPHPTERGRSEASSIVSEVPDYLFGLETTSGEPSP
GPAAARAKSDATETPRHHDDDECDVPPSARQMPYVVEGASSWPAPPPPYMAQPVYYFPVP
PPVHYLEPSAQGGYMPRPVYHIVGGGGSEAPGGDLHAAGGVYGVPQHMQAFPPMMYAPPR
AVVYNYNSEGMPSLPPEGGAHSS*

MTSPTSHHPDSSTPHAGIGNGNGGNHHLHPPTLTPAPASTPAAPPAHAHGGPQVRLMCSF
GGRILPRPGDRQLRYVGGETRIVSFPRAAASFAALVAALAKAAPALFAPGAPRPSLKYQL
PQDDLDSLISVTSDDDVDHLVDELDRIHDLSANVARPPRLRVFLFAPAPAPDAAFGSVLS
GTAGDAAPSDQWFVDALNAPAPHPIERVRSESSSIVSDVPDYLFSLDSPSDDPSPGPSAA
RAKSDATETPHHHGDDVPPSARQIPHVAGGASSWPAPPPPYMAQPMYYFPVPPPVHYLDQ
SAQSGYMPRPIYHIVGGGGSEAPGGDLHAAGGVYGVSHHMQGFPPMMYAPPRAVIYNYKS
EGMPSLPPEGGAHSS*

Other information
Ka divergence:0.17041KaKs divergence:0.322952
GC content 1 (%):71GC content 2 (%):72GC content divergence:0.007
Length 1 (bp):1152Length 2 (bp):1128Length divergence:-0.011
MFE 1 (kcal):-506.41MFE 2 (kcal):-478.3MFE divergence-0.029