Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G129987-GRMZM2G075485
Species:maize
Duplication type:WGD
Function (paralog1):chaperone protein dnaJ 6
Function (paralog2):hypothetical protein LOC100273764

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGRKGRKARVSRDADVDGSEDEMAAAPAAAAGRSLYEILGVEKTASQQEIKKAYHKLALR
LHPDKNPGDEEAKEKFQQLQKVISILGDAEKRALYDETGITDDDALVGEAANDLQEYFRT
MYKKVTEADIEEFEAKYRGSDSEKTDLKELYTKYKGNMNRLFCTMICSEPKLDSHRFKDI
IDGAIAEGELKSTKAYEKWSKKISEMEPPTNPLERRAKSRKKSEENDLILAISQRRAERK
NQFNSILSNIMSKCDSKASSSEPTEEEFELARQRLESKMAKRRK*

MGRNRKGRKARVSHDADADADADGSEDERATTAGRSLYEILGVEKTASQQEIKKAYHKLA
LRLHPDKNPGDEEAKEKFQQLQKVISILGDVEKRALYDETGITDDDALVGEAANNLQEYF
RTMYKKVTEADIEEFEAKYRGSDSEKTDLKELYTKYKGNMNRLFCAMICSEPKLDSHRFK
DIIDEAIGEGELKSTKVYEKWAKKISGMEPPTNPLERRVKKRKNSEENDLILAISQRRAE
RKKQFNSILSNIMSKCDSKASSSEPTEEEFEQAQQRLESRRAKRRK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):855Length 2 (bp):861Length divergence:0.003
MFE 1 (kcal):-271.19MFE 2 (kcal):-274.44MFE divergence0.006